Recombinant Full Length Synechocystis Sp. Thylakoid Membrane Protein Slr0575(Slr0575) Protein, His-Tagged
Cat.No. : | RFL30019SF |
Product Overview : | Recombinant Full Length Synechocystis sp. Thylakoid membrane protein slr0575(slr0575) Protein (Q55403) (1-184aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-184) |
Form : | Lyophilized powder |
AA Sequence : | MLPKISLAAVGLTVGGILTITGFVAYALDYATLNLAGFFYGIPLVLGGLALKAAELKPIP FSQPTSEKIIALRNQLATPTQNQIRKDVTRYRYGQEAHLDESLERLGLSPTDEERPVLTS LLEQDWEGKYVLTLTFTSPFISLETWQEKQEKIAKFFGPDLEVTVAEPEEKVVTVNLISQ LALP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slr0575 |
Synonyms | slr0575; Thylakoid membrane protein slr0575 |
UniProt ID | Q55403 |
◆ Recombinant Proteins | ||
TXN2-17653M | Recombinant Mouse TXN2 Protein | +Inquiry |
sapA-4544C | Recombinant Campylobacter fetus sapA protein, His&Myc-tagged | +Inquiry |
COL22A1-3884C | Recombinant Chicken COL22A1 | +Inquiry |
ADIPOQ-247R | Recombinant Rhesus monkey ADIPOQ Protein, His-tagged | +Inquiry |
CCL35.1-6515Z | Recombinant Zebrafish CCL35.1 | +Inquiry |
◆ Native Proteins | ||
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
Lectin-1738S | Active Native Sambucus Nigra Lectin Protein, Fluorescein labeled | +Inquiry |
Lectin-1861W | Active Native Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC2-5605HCL | Recombinant Human HDAC2 293 Cell Lysate | +Inquiry |
PTTG2-2666HCL | Recombinant Human PTTG2 293 Cell Lysate | +Inquiry |
LTBR-1052RCL | Recombinant Rat LTBR cell lysate | +Inquiry |
SEPT9-1952HCL | Recombinant Human SEPT9 293 Cell Lysate | +Inquiry |
SLC7A6OS-1696HCL | Recombinant Human SLC7A6OS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All slr0575 Products
Required fields are marked with *
My Review for All slr0575 Products
Required fields are marked with *
0
Inquiry Basket