Recombinant Full Length Synechocystis Sp. Photosystem Q(B) Protein 1 Protein, His-Tagged
Cat.No. : | RFL31274SF |
Product Overview : | Recombinant Full Length Synechocystis sp. Photosystem Q(B) protein 1 Protein (P07826) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MTTTQLGLQEQSLWSRFCCWITSTSNRLYIGWFGVLMIPTLLTATTCFIIAFIAAPPVDI DGIREPIAGSLLYGNNIITAAVVPSSNAIGLHFYPIWEAHSLDEWLYNGGPYQLIVFHFL IGIFCYLGRQWELSYRLGMRPWICVAYSAPVAAATATLLIYSIGQGSFSDGLPLGISGTF NFMLVLQAEHNVLMHPFHMLGVAGVFGGALFAAMHGSLVTSSLIRETTEVESQNQGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVVGIWFAALAVCCFAFNLNGF NFNQSILDAQGRPVSTWADVINRANIGFEVMHERNVHNFPLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA1 |
Synonyms | psbA1; psbA-1; slr1181; Photosystem II protein D1 1; PSII D1 protein 1; Photosystem II Q(B protein 1 |
UniProt ID | P07826 |
◆ Recombinant Proteins | ||
ABCB11-8135H | Recombinant Human ABCB11 protein, His & T7-tagged | +Inquiry |
DIAP1-2374M | Recombinant Mouse DIAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL31424FF | Recombinant Full Length Cat T-Cell Surface Glycoprotein Cd8 Beta Chain(Cd8B) Protein, His-Tagged | +Inquiry |
YQBR-3066B | Recombinant Bacillus subtilis YQBR protein, His-tagged | +Inquiry |
Kitl-3697M | Active Recombinant Mouse Kitl Protein | +Inquiry |
◆ Native Proteins | ||
OVAL-140C | Native Chicken ovalbumin | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
LN-2686M | Native Mouse LN Protein | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC36-7766HCL | Recombinant Human CCDC36 293 Cell Lysate | +Inquiry |
Spleen-675H | Hamster Spleen Lysate, Total Protein | +Inquiry |
HINT2-5557HCL | Recombinant Human HINT2 293 Cell Lysate | +Inquiry |
PTPRO-2674HCL | Recombinant Human PTPRO 293 Cell Lysate | +Inquiry |
TLR4-402HCL | Recombinant Human TLR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbA1 Products
Required fields are marked with *
My Review for All psbA1 Products
Required fields are marked with *
0
Inquiry Basket