Recombinant Full Length Synechocystis Sp. Fatty Acid Desaturase(Desa) Protein, His-Tagged
Cat.No. : | RFL31311SF |
Product Overview : | Recombinant Full Length Synechocystis sp. Fatty acid desaturase(desA) Protein (P20388) (1-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-351) |
Form : | Lyophilized powder |
AA Sequence : | MTATIPPLTPTVTPSNPDRPIADLKLQDIIKTLPKECFEKKASKAWASVLITLGAIAVGY LGIIYLPWYCLPITWIWTGTALTGAFVVGHDCGHRSFAKKRWVNDLVGHIAFAPLIYPFH SWRLLHDHHHLHTNKIEVDNAWDPWSVEAFQASPAIVRLFYRAIRGPFWWTGSIFHWSLM HFKLSNFAQRDRNKVKLSIAVVFLFAAIAFPALIITTGVWGFVKFWLMPWLVYHFWMSTF TIVHHTIPEIRFRPAADWSAAEAQLNGTVHCDYPRWVEVLCHDINVHIPHHLSVAIPSYN LRLAHGSLKENWGPFLYERTFNWQLMQQISGQCHLYDPEHGYRTFGSLKKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | desA |
Synonyms | desA; slr1350; Delta(12-fatty-acid desaturase |
UniProt ID | P20388 |
◆ Recombinant Proteins | ||
Ppie-7041M | Recombinant Mouse Ppie protein, His & T7-tagged | +Inquiry |
ITGB3-151H | Recombinant Human ITGB3 Protein, DYKDDDDK-tagged | +Inquiry |
Epcam-283MF | Recombinant Mouse Epcam Protein, His-tagged, FITC conjugated | +Inquiry |
CCDC57-301429H | Recombinant Human CCDC57 protein, GST-tagged | +Inquiry |
SORD-8575M | Recombinant Mouse SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
F2-73R | Native Rat Prothrombin | +Inquiry |
GG-190H | Native Horse Gamma Globulin protein | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-001H5N9CL | Recombinant H5N9 HA cell lysate | +Inquiry |
Peripheral-17H | Human Peripheral blood leukocyte lysate | +Inquiry |
SPATA9-1530HCL | Recombinant Human SPATA9 293 Cell Lysate | +Inquiry |
RDH12-2437HCL | Recombinant Human RDH12 293 Cell Lysate | +Inquiry |
PLEKHJ1-3111HCL | Recombinant Human PLEKHJ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All desA Products
Required fields are marked with *
My Review for All desA Products
Required fields are marked with *
0
Inquiry Basket