Recombinant Full Length Synechococcus Sp. Upf0754 Membrane Protein Syc0451_D(Syc0451_D) Protein, His-Tagged
Cat.No. : | RFL12007SF |
Product Overview : | Recombinant Full Length Synechococcus sp. UPF0754 membrane protein syc0451_d(syc0451_d) Protein (Q5N4X8) (1-412aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-412) |
Form : | Lyophilized powder |
AA Sequence : | MDGRTLGLWLLPPVVGGIIGYFTNDLAIRMLFRPYRPVVIGGWQLPFTPGLIPANQGRLA RRIADAILGSLLTPDALHDLARRLLELPRLEAAIAWLVSLLLERLREVRDPRSIEVAADV LRDLAGSALPRWLRAIVRQRQGLDAQIDRWFEQQLLSQKLGPLQAQQLGDWLLEGAFPPD QIRRVMLDFLTDDNIRNLDRIVRDRTRGTDWVIANLFGVQSSLQRLRQFLREQPEAGDAV IAELSQRLALRQQLSQALQTFQLTDLPQTTLTDLRLQLRQGLRQWLDQDGLSLLEGALGG LDWTAAARALLDRLRTAVISDEAIAAFRHEVALILDQRLEHELEDLVAAALPILALEDLI IGRVEATPAADLEAAIQGIVRSELQAIVNIGGVLGVLLGCVQSLINVWSLST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | syc0451_d |
Synonyms | syc0451_d; UPF0754 membrane protein syc0451_d |
UniProt ID | Q5N4X8 |
◆ Native Proteins | ||
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
F2-5402P | Native Porcine Coagulation Factor II (thrombin) | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
TF-93R | Native Rat Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FANCA-499HCL | Recombinant Human FANCA cell lysate | +Inquiry |
MYC-4039HCL | Recombinant Human MYC 293 Cell Lysate | +Inquiry |
IQCC-5180HCL | Recombinant Human IQCC 293 Cell Lysate | +Inquiry |
TMOD2-916HCL | Recombinant Human TMOD2 293 Cell Lysate | +Inquiry |
CD2BP2-175HCL | Recombinant Human CD2BP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All syc0451_d Products
Required fields are marked with *
My Review for All syc0451_d Products
Required fields are marked with *
0
Inquiry Basket