Recombinant Full Length Synechococcus Sp. Photosystem Q(B) Protein 3(Psba3) Protein, His-Tagged
Cat.No. : | RFL5345SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Photosystem Q(B) protein 3(psbA3) Protein (Q5N337) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MTSILREQRRDNVWDRFCEWVTSTDNRIYVGWFGVLMIPTLLTATICFIVAFIAAPPVDI DGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL LGISCYMGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPIGQGSFSDGMPLGISGTF NFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSMGISTMAFNLNGF NFNQSVLDSQGKVINTWADVLNRANLGMEVMHERNAHNFPLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA3 |
Synonyms | psbA3; psbAI; syc1093_c; Photosystem II protein D1 3; PSII D1 protein 3; Photosystem II Q(B protein 3 |
UniProt ID | Q5N337 |
◆ Recombinant Proteins | ||
SCAND1-2848H | Recombinant Human SCAN Domain Containing 1, His-tagged | +Inquiry |
ITGA3B-7764Z | Recombinant Zebrafish ITGA3B | +Inquiry |
MRPL10-2831R | Recombinant Rhesus monkey MRPL10 Protein, His-tagged | +Inquiry |
NFATC1-4340H | Recombinant Human NFATC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TERT-056H | Recombinant Human TERT protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-399H | Native Human Low Density Lipoprotein, Oxidized | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
CA2-35R | Native Rhesus monkey Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Collagen-319H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
GP6-5821HCL | Recombinant Human GP6 293 Cell Lysate | +Inquiry |
PCDHB6-3390HCL | Recombinant Human PCDHB6 293 Cell Lysate | +Inquiry |
FAF1-6470HCL | Recombinant Human FAF1 293 Cell Lysate | +Inquiry |
ZNF35-90HCL | Recombinant Human ZNF35 293 Cell Lysate | +Inquiry |
PTPN14-2685HCL | Recombinant Human PTPN14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbA3 Products
Required fields are marked with *
My Review for All psbA3 Products
Required fields are marked with *
0
Inquiry Basket