Recombinant Full Length Synechococcus Sp. Photosystem Q(B) Protein 1 Protein, His-Tagged
Cat.No. : | RFL1223SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Photosystem Q(B) protein 1 Protein (A5GTY4) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MQTTIQQRSGASAWQQFCEWVTSTDNRLYVGWFGVLMIPTLLAATTCFIVAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLVIFHFL IGIYAYMGREWELSYRLGMRPWICIAYSAPVAAASAVFLVYPFGQGSFSDAMPLGISGTF NYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDSQGRVLNTWADILNRAGLGMEVMHERNAHNFPLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA1 |
Synonyms | psbA1; SynRCC307_1440; psbA3; SynRCC307_2009; psbA4; SynRCC307_2183; Photosystem II protein D1 1; PSII D1 protein 1; Photosystem II Q(B protein 1 |
UniProt ID | A5GTY4 |
◆ Recombinant Proteins | ||
TRIM65-9619M | Recombinant Mouse TRIM65 Protein, His (Fc)-Avi-tagged | +Inquiry |
HA-3271V | Recombinant Influenza A H5N8 (A/broiler duck/Korea/Buan2/2014) HA protein(Met1-Arg341), His-tagged | +Inquiry |
MSLN-31H | Recombinant Human MSLN Protein, His-tagged | +Inquiry |
YWHAZ-226H | Recombinant Human YWHAZ Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADRM1-11245Z | Recombinant Zebrafish ADRM1 | +Inquiry |
◆ Native Proteins | ||
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
AFP-3017H | Native Human fetal cord serum | +Inquiry |
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
LOC200383-1003HCL | Recombinant Human LOC200383 cell lysate | +Inquiry |
Liver-296R | Rat Liver Membrane Lysate | +Inquiry |
RFXANK-2394HCL | Recombinant Human RFXANK 293 Cell Lysate | +Inquiry |
FZD10-2118MCL | Recombinant Mouse FZD10 cell lysate | +Inquiry |
PCDHB16-1298HCL | Recombinant Human PCDHB16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbA1 Products
Required fields are marked with *
My Review for All psbA1 Products
Required fields are marked with *
0
Inquiry Basket