Recombinant Full Length Synechococcus Sp. Nad(P)H-Quinone Oxidoreductase Subunit L(Ndhl) Protein, His-Tagged
Cat.No. : | RFL17470SF |
Product Overview : | Recombinant Full Length Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit L(ndhL) Protein (Q2JRP9) (1-73aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-73) |
Form : | Lyophilized powder |
AA Sequence : | MLSTSTLIGLTYAALAVLYLLVLPFLFLVYVDKRWNYSGAWEKVLMFFLVLFFFPGMVLV APFMTFRPKPRSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhL |
Synonyms | ndhL; CYA_2578; NAD(PH-quinone oxidoreductase subunit L; NAD(PH dehydrogenase I subunit L; NDH-1 subunit L; NDH-L |
UniProt ID | Q2JRP9 |
◆ Recombinant Proteins | ||
ANO9-3291H | Recombinant Human ANO9 protein, His-tagged | +Inquiry |
ALCAM-213H | Active Recombinant Human ALCAM, Fc Chimera | +Inquiry |
HSD17B13-02HFL | Recombinant Full Length Human HSD17B13 Protein, His-tagged | +Inquiry |
ADARB2-316H | Recombinant Human ADARB2 Protein, GST-tagged | +Inquiry |
STRIP1-3757H | Recombinant Human STRIP1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
TF-143C | Native Chicken Serum Transferrin | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
Serpinc1-5485M | Native Mouse Serpin (or cysteine) Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
VMA21-403HCL | Recombinant Human VMA21 293 Cell Lysate | +Inquiry |
PHLDA3-3219HCL | Recombinant Human PHLDA3 293 Cell Lysate | +Inquiry |
ACSL5-9073HCL | Recombinant Human ACSL5 293 Cell Lysate | +Inquiry |
ATP4A-8608HCL | Recombinant Human ATP4A 293 Cell Lysate | +Inquiry |
KCND3-5068HCL | Recombinant Human KCND3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhL Products
Required fields are marked with *
My Review for All ndhL Products
Required fields are marked with *
0
Inquiry Basket