Recombinant Full Length Synechococcus Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL36805SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (Q9R6T0) (1-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-456) |
Form : | Lyophilized powder |
AA Sequence : | MTSDPLASPSFADRWRRGQQLFWTWLADLRLAILLLLAIAIASATGTVIEQGQSLAFYQE NYPTDPALFGFLSWRWILSLGLDHVYRAGWFLGLLILFGASLTACTFRRQWPALRAAQRW QFYQEPRQFTKLALSASLPQGKLDSLEPLLLQRRYRLFRADDVLYARRGLAGRVGPILVH AGMLVVLGGAIWGSLGGFYAQEMIPSGETFQVRNIVDAGPWSGSRIPQDWAVKVNRFWID YAPDGRIDQFYSDLSVVDREGQEQDRQTIHVNQPLRYGGLTFYQADWAIAAAQVRLNNSP VLQLPMAQLPAAGRIWGTFVPTKPDLSSGVSLIAKDLQGTAVIYGSNGEPLGTLRKGMAI EVEGIRLSLVDLVGSTGLQIKSDPGIPWVYAGFLFVMVGVVCSYVSHAQVWALEQDGQLY IGGRSNRALVAFEQEMLAVLAQLDAQSNHSAETAIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; syc1191_d; Cytochrome c biogenesis protein CcsB |
UniProt ID | Q9R6T0 |
◆ Native Proteins | ||
PeptideD-724E | Native Ebola virus Delta Peptide | +Inquiry |
Prothrombin-293M | Native Mouse Prothrombin Frag-1 | +Inquiry |
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
IgG-7439M | Native Mouse IgG Fc Protein | +Inquiry |
IgG-339H | Native Horse IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
NETO1-2197HCL | Recombinant Human NETO1 cell lysate | +Inquiry |
SNRNP40-1622HCL | Recombinant Human SNRNP40 293 Cell Lysate | +Inquiry |
SNRPD2-1614HCL | Recombinant Human SNRPD2 293 Cell Lysate | +Inquiry |
KTI12-4834HCL | Recombinant Human KTI12 293 Cell Lysate | +Inquiry |
A431-005HCL | Human EGF Stimulated A431 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket