Recombinant Full Length Synechococcus Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL712SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (Q3AZN7) (1-426aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-426) |
Form : | Lyophilized powder |
AA Sequence : | MKRLIAWLSDLRVAIVLLFLIALASAVGTAIPQGDAPRSYVEAYATRPWLGLLNGEQVLQ LQLDHVYSSVWFLSLLAWLGLALILCSWRRQWPALQAARRWIDYSNPRQLSKLAIAESLP CTDSNSALQAFSTVLSQQGWRLERKDNRLAARKGTAGRVGPLLVHTGLILLMLGAVWGVL AGNRLERFLAPGRTLDLLSRDGDSQVSILLEAFQVDRDPAGRAEQFRSQLHLEENGNSLD REISVNHPLRHRGITIYQADWSLAAITLQIGRSPQLQLALRSFPELGEQVWGLVLPTRPD GSEPVFLSVENEQGPINIFDTDGTLLTLLRPGGPAVDVKGLPMRVNSVLPASGLLLKRDP GVPLVYLGFAVMLIGGGLSLIATRQLWAIASEGQLHVGGLCNRNLTAFSKELPSLLRQTA LAHQQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; Syncc9902_0472; Cytochrome c biogenesis protein CcsB |
UniProt ID | Q3AZN7 |
◆ Native Proteins | ||
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
C1R-96H | Active Native Human C1r Enzyme | +Inquiry |
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
HB-41D | Native Dog Hemoglobin (HB) Protein | +Inquiry |
IgG-353C | Native Chicken IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMC4-2761HCL | Recombinant Human PSMC4 293 Cell Lysate | +Inquiry |
TM4SF18-668HCL | Recombinant Human TM4SF18 lysate | +Inquiry |
TMPRSS15-2800HCL | Recombinant Human PRSS7 293 Cell Lysate | +Inquiry |
MT1H-4100HCL | Recombinant Human MT1H 293 Cell Lysate | +Inquiry |
AHSA1-8961HCL | Recombinant Human AHSA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket