Recombinant Full Length Synechococcus Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL17468SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (Q3AHI9) (1-432aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-432) |
Form : | Lyophilized powder |
AA Sequence : | MASGMGPLKRLAAWFSDLRLAIVLLLLIALASAVGTGIPQGDPPSSYIDAYSDTPWLGLL HGEQVLQLQLDHVYSSGWFLALLAWLGLALILCSWRRQWPALMAARRWIDYRTTRQLSKL AIAESQPCPDTSQGLTQLETVLRASGWQVQRKPQRLAARRGAIGRVGPLLVHTGLVLLML GAAWGALAGNRLERFLAPGRSLDLLDRDGTSQLTITLDRFAIDRDPAGRTEQFRSALKLQ GPNQSLDAEISVNHPLRHRGITVYQADWSLATISLQIGRSPVLELPLQTYPELGDQIWGL VLPTRPDGTEPVFLSLESEQGPATVFDADGQQLARLRPGGPSAEVKGLPMRVDAVLPASG LLLKRDPGVPLVYLGFAVLLVGGGLSLVATRQLWAIAADGTLSVGGLCNRNLAAFATELP QLLQQVVVDQQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; Syncc9605_2204; Cytochrome c biogenesis protein CcsB |
UniProt ID | Q3AHI9 |
◆ Recombinant Proteins | ||
HTR2B-7933M | Recombinant Mouse HTR2B Protein | +Inquiry |
MNDA-5613M | Recombinant Mouse MNDA Protein, His (Fc)-Avi-tagged | +Inquiry |
EPHA2-152HF | Recombinant Full Length Human EPHA2 Protein | +Inquiry |
YNET-3168B | Recombinant Bacillus subtilis YNET protein, His-tagged | +Inquiry |
torA-6908E | Recombinant Escherichia coli (strain K12) torA protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
HPX-206H | Native Human Native Human HPX | +Inquiry |
Collagen Type I-524B | Native Bovine Collagen Type I Protein, FITC-conjugated | +Inquiry |
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QB-651HCL | Recombinant Human C1QB cell lysate | +Inquiry |
GRK5-640HCL | Recombinant Human GRK5 cell lysate | +Inquiry |
CNN2-7405HCL | Recombinant Human CNN2 293 Cell Lysate | +Inquiry |
ZNF385D-82HCL | Recombinant Human ZNF385D 293 Cell Lysate | +Inquiry |
Parotid-439S | Sheep Parotid Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket