Recombinant Full Length Synechococcus Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL25750SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (O68616) (1-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-462) |
Form : | Lyophilized powder |
AA Sequence : | MTVSDSSPNSPWHSFPRKVWRTGLKWIADLRVAIALLLLISVFSILGTVIEQGSTIQFYQ ENYPEDPALLGFLSWKVLLGLGLDHVYTTWWYLVLLLAFGVSLIACTFRRQLPALKTARN WNYYSQARQFNKLALSTELDHGSLQSLKPQLEKKRYKIFQDGEKLYARKGIVGRIGPIIV HIGMIVTLVGSIWGAFGGFMAQEMIPSGVNFKVNNVFKAGIFSESDRPWSVNVNRFWIDY TPTGDIDQFYSDLSVVDGEGQELERKTISVNHPLRYDGITFYQTSWSIGGVQVQLNNSPI FQLPAAQIPTENGAKLWGSWVPIKPDMSAGVSILMQDLQGSAIVYNEQGELVGAVRVGDR LDVGDISLKLVDLVGSTGLQIKADPGVPVVYTGFLLVMLGVVMSYVSYSQVWALAAGDRF YLGGKTNRAQVAFERELLEIINTLETSHSQATPENTLTSIEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; SYNPCC7002_A1088; Cytochrome c biogenesis protein CcsB |
UniProt ID | O68616 |
◆ Recombinant Proteins | ||
C1D-352C | Recombinant Cynomolgus C1D Protein, His-tagged | +Inquiry |
ST1916-P03-1488S | Recombinant Streptomyces lividans ST1916_P03 protein, His-tagged | +Inquiry |
KRT5-8770Z | Recombinant Zebrafish KRT5 | +Inquiry |
WHSC1-146H | Recombinant Human WHSC1(E1099K) Protein, His-tagged | +Inquiry |
UBE2T-2297H | Recombinant Human UBE2T Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
BSI-B4-851 | Active Native Bandeiraea simplicifolia Isolectin B4 protein, biotin-conjugated | +Inquiry |
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
Arp 2/3 complex-856P | Native Porcine Arp 2/3 complex Protein | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEMD3-4776HCL | Recombinant Human LEMD3 293 Cell Lysate | +Inquiry |
ZC3H14-1958HCL | Recombinant Human ZC3H14 cell lysate | +Inquiry |
GALNT12-681HCL | Recombinant Human GALNT12 cell lysate | +Inquiry |
APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
TPP2-840HCL | Recombinant Human TPP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket