Recombinant Full Length Synechococcus Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL22388SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (A5GNE2) (1-430aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-430) |
Form : | Lyophilized powder |
AA Sequence : | MRTLNRVFAILSDLRLAIALLLLIAAASAVGTILPQQEAPELYLERFNADPWLGLINGDQ MLAFQLDHLYSSVWFLALLAWLGLALMLCSWRRQWPALQAAMRWIDYTRPRQLSKLALAE TLSCASSDGALSSLAIELKSRGWQVKQHQDRLAARRGVVGRVGPLLVHTGLVLLLIGAAW GALAGQRLERFLAPGRSLDLLDPAGANRLSLTLENFSITRDPAGRAEQFQSTLTLSPPGQ EDERRTISVNHPLRYQGMTVYQADWSLAAVTVQIGKSPMLQLPLSTFPELGDQVWGLVLP TRPDGSEPVFLSTSSEQGPVQVFGSDGALITNLRPGGEGTEVRGLPLKVIDILPASGLLL KRDPGVPLVYAGFAITLLGGALSMVATRQIWVISDAVHQRLHIGGLCNRNLLGFAAELPE LINRVDVSHG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; SynWH7803_2031; Cytochrome c biogenesis protein CcsB |
UniProt ID | A5GNE2 |
◆ Recombinant Proteins | ||
TOP1MT-247Z | Recombinant Zebrafish TOP1MT | +Inquiry |
CRMP1-11585H | Recombinant Human CRMP1, GST-tagged | +Inquiry |
Apoh-1133R | Recombinant Rat Apoh Protein, His-tagged | +Inquiry |
SAMD12-7889M | Recombinant Mouse SAMD12 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL16636AF | Recombinant Full Length Aegilops Tauschii Chloroplast Envelope Membrane Protein(Cema) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
VTN-31735TH | Native Human VTN | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
LDL-404H | Native Human Low Density Lipoprotein, Oxidized, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENOX1-6596HCL | Recombinant Human ENOX1 293 Cell Lysate | +Inquiry |
KRTAP13-2-4851HCL | Recombinant Human KRTAP13 293 Cell Lysate | +Inquiry |
IL26-5230HCL | Recombinant Human IL26 293 Cell Lysate | +Inquiry |
RPL37A-2197HCL | Recombinant Human RPL37A 293 Cell Lysate | +Inquiry |
Fetal Esophagus-140H | Human Fetal Esophagus Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket