Recombinant Full Length Synechococcus Sp. Apocytochrome F(Peta) Protein, His-Tagged
Cat.No. : | RFL1591SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Apocytochrome f(petA) Protein (Q2JUP0) (25-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-327) |
Form : | Lyophilized powder |
AA Sequence : | YPYYAQMAYDNPREATGKIVCANCHLNAMPARAEVPQAVTPGQVFTIKVGIPYDLSKQQV LADGSKGGLNVGAVVVLPEGFRLATEEEMTEEQRQETAETYITPYSDEKPNILLVGPLPG EQHQEIVFPVVAPDPKEDPSVAFMKYRVYIGANRGRGQINPDGSLSNNNVFRAPATGRLT SIATIESDLSDLPPELAALVPPEYELPGTRVLSFETEGGLKHLVVPPGPELVVNIGDSVQ EGDPVTNNPNVGGFGQVERDLVLQNPERVKWLVAFLAAVAITQLLLVLKKKQVELIQAAE LLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petA |
Synonyms | petA; CYA_1404; Cytochrome f |
UniProt ID | Q2JUP0 |
◆ Recombinant Proteins | ||
CDY1-1658H | Recombinant Human CDY1 protein, His & GST-tagged | +Inquiry |
ACSL4-471R | Recombinant Rat ACSL4 Protein | +Inquiry |
SPESP1-5361R | Recombinant Rat SPESP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL10768SF | Recombinant Full Length Shewanella Sp. Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
MED10-2716R | Recombinant Rhesus monkey MED10 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CELA1-52P | Active Native Porcine pancreatic elastase | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
SHBG-8259H | Native Human Serum Sex Hormone Binding Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
UPP2-493HCL | Recombinant Human UPP2 293 Cell Lysate | +Inquiry |
CPM-2515HCL | Recombinant Human CPM cell lysate | +Inquiry |
FLI1-6195HCL | Recombinant Human FLI1 293 Cell Lysate | +Inquiry |
MAP2K3-4510HCL | Recombinant Human MAP2K3 293 Cell Lysate | +Inquiry |
NCR3-2652HCL | Recombinant Human NCR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All petA Products
Required fields are marked with *
My Review for All petA Products
Required fields are marked with *
0
Inquiry Basket