Recombinant Full Length Swarming Motility Regulation Sensor Protein Rssa(Rssa) Protein, His-Tagged
Cat.No. : | RFL2582SF |
Product Overview : | Recombinant Full Length Swarming motility regulation sensor protein rssA(rssA) Protein (Q8GP19) (1-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Serratia marcescens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-469) |
Form : | Lyophilized powder |
AA Sequence : | MIGFKSFFMRTIIFQVLAILLLWGLLVAWVKYWYYPDMEKYFDNQQRIVAAGIANILDET GTDNIDYRGIIKTIEGMYIDSINNGMQDEIDYHPLFVVYDRDNRVLYSSQTQGEPLRLPP SVLSGSVNYAGANWHLAGSWKEKRQYRVIVGESFNDRTTLFGNPADVPLLGILAAIIVTL LFTAYFSLRPLRQIARTISDRQPGNLSPINVSEQYQEIRPVVMEVNKLMARIDAANQREK RFMADAAHELRTPIAAVLAQLHLLTQVTEQQERREIIGDMQQGLDRAASLSRQLINLAKL EAEDFPLKIEAVDIYAEIGKCIAQHVPYALEKDVELSLDGSEDVVVSTDRRALIAIFTNL LDNALKYAPPGSRIEANIRSLAPLGCYITLRDNGPGVSEEHRSRLFERFYRVPGTQQTGS GLGLAIARNLADKIGAQLRVTEGLDDRGIGFIIDLPESYRPQTESEPRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rssA |
Synonyms | rssA; Swarming motility regulation sensor protein RssA |
UniProt ID | Q8GP19 |
◆ Recombinant Proteins | ||
KCNE4-8494M | Recombinant Mouse KCNE4 Protein | +Inquiry |
EMWEY_00058460-1110E | Recombinant Eimeria maxima EMWEY_00058460 Protein (Full Length), N-His tagged | +Inquiry |
GAMT-3009H | Recombinant Human GAMT Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL13906KF | Recombinant Full Length Klebsiella Pneumoniae Protein Aaex(Aaex) Protein, His-Tagged | +Inquiry |
ARID4B-431R | Recombinant Rat ARID4B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C5a-12H | Active Native Human C5a Anaphylatoxin Protein | +Inquiry |
Uricase-089P | Active Native Porcine Uricase Protein | +Inquiry |
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
Proteoglycans-51C | Native Chicken Proteoglycans | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNTG1-1607HCL | Recombinant Human SNTG1 293 Cell Lysate | +Inquiry |
TPM2-843HCL | Recombinant Human TPM2 293 Cell Lysate | +Inquiry |
S100A4-2859HCL | Recombinant Human S100A4 cell lysate | +Inquiry |
PELO-3302HCL | Recombinant Human PELO 293 Cell Lysate | +Inquiry |
NUP133-3633HCL | Recombinant Human NUP133 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rssA Products
Required fields are marked with *
My Review for All rssA Products
Required fields are marked with *
0
Inquiry Basket