Recombinant Full Length Surf1-Like Protein(Sft-1) Protein, His-Tagged
Cat.No. : | RFL34373CF |
Product Overview : | Recombinant Full Length SURF1-like protein(sft-1) Protein (A8Y2C9) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis briggsae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MAFRWAIQMALRRGGGGGQRLLLTQHQHQNYQFFKTSSSTQFSTRNSQILDLDTPQKSPN FSENSKNKKSKKIEWSTGSILMLGLPAFAFSLGVWQIYRLIWKLELIEHLKSRLSQEAIE LPDDLSSSSLEPLEYCRVRVTGEFLHQKEFVISPRGRFDPAKKTSASVGSMLSENEMSSH GGHLITPFRLKNTGKVILINRGWLPTFYFDPESHAKTNPQGTVILEAIVRKTEQRPQFVG QNVPEQGVWYYRDLEQMAKWHGTEPVWLDAAYETTVPGGPIGGQTNINVRNEHMNYLTTW FTLTLVTMLMWIHKFRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sft-1 |
Synonyms | sft-1; CBG22468; SURF1-like protein |
UniProt ID | A8Y2C9 |
◆ Recombinant Proteins | ||
LPPR1-2364R | Recombinant Rhesus Macaque LPPR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF610-096H | Recombinant Human ZNF610 Protein, HIS-tagged | +Inquiry |
DDX42-1044R | Recombinant Rhesus Macaque DDX42 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ints9-2435M | Recombinant Mouse Ints9 Protein, Myc/DDK-tagged | +Inquiry |
Ccl19-723R | Recombinant Rat Ccl19 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1769D | Active Native Dolichos Biflorus Agglutinin Protein, Biotinylated | +Inquiry |
ATP6AP2-27064TH | Native Human ATP6AP2 | +Inquiry |
F9-301R | Native Rat Factor IXa | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIF1B-4951HCL | Recombinant Human KIF1B 293 Cell Lysate | +Inquiry |
TRMT2B-427HCL | Recombinant Human TRMT2B cell lysate | +Inquiry |
ORAI2-3554HCL | Recombinant Human ORAI2 293 Cell Lysate | +Inquiry |
SH3BP2-1871HCL | Recombinant Human SH3BP2 293 Cell Lysate | +Inquiry |
AGPAT1-36HCL | Recombinant Human AGPAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sft-1 Products
Required fields are marked with *
My Review for All sft-1 Products
Required fields are marked with *
0
Inquiry Basket