Recombinant Full Length Sulfurovum Sp. Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL8658SF |
Product Overview : | Recombinant Full Length Sulfurovum sp. ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (A6QBN8) (1-671aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sulfurovum sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-671) |
Form : | Lyophilized powder |
AA Sequence : | MANPNNNNDNKQNNNNNFFNDNPLLAFAIFSIVIILIFKSFVGEGESLGTMMNTQGVAQT KQVKYSEIKKRIEEGAVKSVKLTPSMVEAIIEDNGRKVRYVAQNVPTYDRDLIPLLDKKK ISYEGVVGNGFFSELISMMLPILIFFAIWIFLAKKMSKGMGGGILGAGKADKLINSEKPD TRFDDVQGVEEAKDEVKEIVDFLKFPERYIELGAKIPKGVLLVGPPGTGKTLLAKAVAGE ASVPFFSVSGSGFIEMFVGVGASRVRDLFAQAKKEAPSIIFIDEIDAIGKSRASGGQMGG NDEREQTLNQLLAEMDGFGTDTPVIVLAATNRPETLDAALLRAGRFDRQVLVDKPDFEGR LAILKVHSKDVKLAPNVDLEIVAKQTAGLAGADLANIINEAALLAGRQNKKQIEQSDLLE AIERSFVGLEKKNRKINETEKKIVAYHESGHALMSELSEGATRVTKVSIIPRGLGALGYT LHLPEDEERFLKQKHELMAEVDVLLGGRAAEDVFIGEISTGAGNDLDRATAILKDMVSVY GMTDVAGLMVLSRSQNSFLGAGAVSTDYSDKTAEAMDSYIKSTLNERYGYVKETLQNYYG AIDNMAKELLGTEVIEGKTVRRIIEEYEQEKGMPSRLAHKDKVAKNKAEADKKEEALKKE ISEESDNNKEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; SUN_1953; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | A6QBN8 |
◆ Recombinant Proteins | ||
RFL11928TF | Recombinant Full Length Treponema Pallidum Motility Protein A(Mota) Protein, His-Tagged | +Inquiry |
FGFR1-2914H | Recombinant Human FGFR1 protein, His-tagged | +Inquiry |
PKN2-1236H | Recombinant Human PKN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Azin1-1795M | Recombinant Mouse Azin1 Protein, Myc/DDK-tagged | +Inquiry |
SLC35F1-4096R | Recombinant Rhesus Macaque SLC35F1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
CFI-105H | Active Native Human Factor I | +Inquiry |
Complement C3d-48H | Native Human Complement C3d | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL50-4159HCL | Recombinant Human MRPL50 293 Cell Lysate | +Inquiry |
HA-2670HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
HA-008H7N9HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
AMOTL1-71HCL | Recombinant Human AMOTL1 cell lysate | +Inquiry |
C8G-130HCL | Recombinant Human C8G lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket