Recombinant Full Length Sulfolobus Islandicus Rod-Shaped Virus 1 Uncharacterized Protein 510(510) Protein, His-Tagged
Cat.No. : | RFL21546SF |
Product Overview : | Recombinant Full Length Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 510(510) Protein (Q8QL30) (20-510aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sulfolobus islandicus rod-shaped virus 1 (SIRV-1) (Sulfolobus virus SIRV-1) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-510) |
Form : | Lyophilized powder |
AA Sequence : | FIKSIMYDIYIHYAICKFIFLLEIYKLIAMGKRKGQRNIASMKYHLYNKILNRKSFPAFS VMFDAGVESVLPTPLENIQIPLGINTNYGIAYASIISSLLSALNNLAISVFNPNFNSQTF LNLGQSANFGISNGISLLNNYTSLYDNYVQLCNILYQPAVFDETYFDLSVYQPALATEYQ NQSCKKIEQYFSSLTTTNVSVNVTTLGTGITNIPNVDNYMYNNIADTGIIDLLNALNINF NQLPDFAKFIIAFIPDLNSIINNGFALDVGWLDRCVLAPETQNGIQLQNGMILQYFADVF GMILDYTPLDFAVLMPEFNPENVTQDDLIAILSADKTVISIFGNLFKMHLYDPSPGGINI AYSSEIENYAVSYQQFLQIQKIVNKKYSNIWYAKMVASATIEIARYPYQQNYSYTSGKRT LSYQDFLNYWKTKWKFYGLTDQDLQYAQQLGEQLQGQAKIENQIKLAQKSAKTKQYKPIF YYKNFQNIAVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | 510 |
Synonyms | 510; Uncharacterized protein 510 |
UniProt ID | Q8QL30 |
◆ Recombinant Proteins | ||
SGCD-15030M | Recombinant Mouse SGCD Protein | +Inquiry |
IRAK4-8295M | Recombinant Mouse IRAK4 Protein | +Inquiry |
CNTN1-1503R | Recombinant Rat CNTN1 Protein | +Inquiry |
CRYGS1-2083Z | Recombinant Zebrafish CRYGS1 | +Inquiry |
HSPB3-5778Z | Recombinant Zebrafish HSPB3 | +Inquiry |
◆ Native Proteins | ||
CTSH-27404TH | Native Human CTSH | +Inquiry |
Lectin-1715U | Native Ulex europaeus Lectin, FITC conjugated | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR1-001HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
GFRA1-2692MCL | Recombinant Mouse GFRA1 cell lysate | +Inquiry |
LRPAP1-2168MCL | Recombinant Mouse LRPAP1 cell lysate | +Inquiry |
CDK18-7631HCL | Recombinant Human CDK18 293 Cell Lysate | +Inquiry |
CCDC137-154HCL | Recombinant Human CCDC137 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All 510 Products
Required fields are marked with *
My Review for All 510 Products
Required fields are marked with *
0
Inquiry Basket