Recombinant Full Length Sulfolobus Islandicus Filamentous Virus Putative Transmembrane Protein 74(Sifv0074) Protein, His-Tagged

• Cat.No.: RFL19698SF
• Product Overview: Recombinant Full Length Sulfolobus islandicus filamentous virus Putative transmembrane protein 74(SIFV0074) Protein (Q914F8) (1-60aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV)
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-60)
• Form: Lyophilized powder
• AA Sequence: MNYFSVIMYLINSVIFTFMIFLTFVNPSLLNDQYWVYILIGFFTAIVFHSGYQAGKGSEK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: SIFV0074
• Synonyms: SIFV0074; Putative transmembrane protein 74
• UniProt ID: Q914F8