Recombinant Full Length Sulcia Muelleri Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL11595SF |
Product Overview : | Recombinant Full Length Sulcia muelleri ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (D5D8E3) (1-619aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sulcia muelleri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-619) |
Form : | Lyophilized powder |
AA Sequence : | MDKQSKFRIKTFFKKIIFFLIIFCFFYFFNFIKKTKKITHTTQDKFFELLSKNKINKFIV LNKKKVSFTLNEKKSHLDSNNYNFFSKLHLSRYEFEIGDLQLFQKKIDFYKELYEINPNF EFKNYKIYTVLNFFYDYGFFLMIIIICWIFIFRKIASRSSESEFKFKIGKSKAKLYYYNN ITFKDVAGLEGPKEEIKEIVDFLKSPNKYTKLGGKIPKGALLIGPPGTGKTLLAKAVAGE AQVPFFSLSGSDFVEMFVGVGASRVRDLFYIAKLKSPSIIFIDEIDAIGRARIKNNIPGG NDERENTLNKLLTEMDGFSTKTNVIVLAATNRYDVLDDALLRSGRFDRTIFIDLPSLKER KDIMKVHLKKIKFSKSIDLDFISRQIPGFSGADISNICNEAALLAARRNKVKVETKDFID TIYRRIGGIEKKNILIKKNEKKRIAYHETGHAIISWIIEYAHSVFQITITPRGQSLGAAW YIPEERQITTEDQMKDEICTLLGGRAAEYLIFNNKSTGALNDLERITKQAQSMVKFFGLS SLGNISYFDSTGRNDFSLEKAYSEKTSEIIDKEINKIIKEQYKRALEILKKNYDKLIFLA EKLFKKEVLFKEDFASILD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; DMIN_00030; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | D5D8E3 |
◆ Recombinant Proteins | ||
BIN1-221H | Recombinant Human BIN1 Protein, GST-tagged | +Inquiry |
PTHLH-4480R | Recombinant Rat PTHLH Protein, His (Fc)-Avi-tagged | +Inquiry |
TNR-2230H | Recombinant Human TNR Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33886HF | Recombinant Full Length Human Clarin-3(Clrn3) Protein, His-Tagged | +Inquiry |
MINPP1-5351H | Recombinant Human MINPP1 Protein (Ser31-Leu487), C-His tagged | +Inquiry |
◆ Native Proteins | ||
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
F10-296M | Active Native Mouse Factor Xa | +Inquiry |
IgG-356B | Native Bovine Gamma Globulin Fraction | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
IBVF0406-225I | Native Influenza (B/Florida 04/06) IBVF0406 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL21-4188HCL | Recombinant Human MRPL21 293 Cell Lysate | +Inquiry |
PAK2-1276HCL | Recombinant Human PAK2 cell lysate | +Inquiry |
SLC25A38-1764HCL | Recombinant Human SLC25A38 293 Cell Lysate | +Inquiry |
CRP-2292MCL | Recombinant Mouse CRP cell lysate | +Inquiry |
PLK1S1-3105HCL | Recombinant Human PLK1S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket