Recombinant Full Length Suid Herpesvirus 1 Envelope Glycoprotein D Protein, His-Tagged
Cat.No. : | RFL21202SF |
Product Overview : | Recombinant Full Length Suid herpesvirus 1 Envelope glycoprotein D Protein (P07645) (18-402aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Suid herpesvirus 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-402) |
Form : | Lyophilized powder |
AA Sequence : | ADVDAVPAPTFPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPLEDPCGVVALISDPQV DRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQVFGRCRRRTTPMWWTP SADYMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQH RTYKFGACWSDDSFKRGVDVMRFLTPFYQQPPHREVVNYWYRKNGRTLPRAHAAATPYAI DPARPSAGSPRPRPRPRPRPRPKPEPAPATPAPPDRLPEPATRDHAAGGRPTPRPPRPET PHRPFAPPAVVPSGWPQPAEPFQPRTPAAPGVSRHRSVIVGTGTAMGALLVGVCVYIFFR LRGAKGYRLLGGPADADELKAQPGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Suid herpesvirus 1 Envelope glycoprotein D |
Synonyms | Envelope glycoprotein D; gD; Protein gp50 |
UniProt ID | P07645 |
◆ Recombinant Proteins | ||
PFKA-0552B | Recombinant Bacillus subtilis PFKA protein, His-tagged | +Inquiry |
DAB1B-3803Z | Recombinant Zebrafish DAB1B | +Inquiry |
DTYMK-3479Z | Recombinant Zebrafish DTYMK | +Inquiry |
ITGA5&ITGB1-1563H | Active Recombinant Human ITGA5&ITGB1 protein, His-tagged | +Inquiry |
RFL8819YF | Recombinant Full Length Yersinia Pestis Bv. Antiqua Electron Transport Complex Protein Rnfe(Rnfe) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HPX-84R | Native Rat Hemopexin | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPB1-3029HCL | Recombinant Human CPB1 cell lysate | +Inquiry |
Sp2-0-Ag14-1677M | Sp2/0-Ag14 (mouse hybridoma) whole cell lysate | +Inquiry |
SLC25A40-1069HCL | Recombinant Human SLC25A40 cell lysate | +Inquiry |
HRH1-5392HCL | Recombinant Human HRH1 293 Cell Lysate | +Inquiry |
APOM-1594HCL | Recombinant Human APOM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Suid herpesvirus 1 Envelope glycoprotein D Products
Required fields are marked with *
My Review for All Suid herpesvirus 1 Envelope glycoprotein D Products
Required fields are marked with *
0
Inquiry Basket