Recombinant Full Length Struthio Camelus Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged
Cat.No. : | RFL34870SF |
Product Overview : | Recombinant Full Length Struthio camelus Cytochrome c oxidase subunit 2(MT-CO2) Protein (O21400) (1-229aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Struthio camelus (Common ostrich) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-229) |
Form : | Lyophilized powder |
AA Sequence : | MANPSQFGFQDASSPIMEELVEFHDHALMVALAICSLVLYLLALMLVEKLSSNTVDAQEV ELIWTILPAIVLILLALPSLQILYMMDEIDEPDLTLKAIGHQWYWSYEYTDFKDLTFDSY MIPTSELPPGHFRLLEVDHRVVVPMESPIRVIITAGDVLHSWAVPTLGVKTDAIPGRLNQ TSFITTRPGIFYGQCSEICGANHSYMPIVVESTPLTYFESWSSLLSTDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-CO2 |
Synonyms | MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II |
UniProt ID | O21400 |
◆ Recombinant Proteins | ||
IL25-182H | Recombinant Active Human IL25 Protein, His-tagged(C-ter) | +Inquiry |
MAP7D1B-6352Z | Recombinant Zebrafish MAP7D1B | +Inquiry |
IL1A-631R | Recombinant Rabbit IL1A protein, His-tagged | +Inquiry |
RFL12673DF | Recombinant Full Length Drosophila Melanogaster Gustatory And Odorant Receptor 63A(Gr63A) Protein, His-Tagged | +Inquiry |
ELOB-5792H | Recombinant Human ELOB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
C1QA-26126TH | Native Human C1QA | +Inquiry |
Lectin-1716U | Native Ulex europaeus Lectin, Biotin conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF343-2015HCL | Recombinant Human ZNF343 cell lysate | +Inquiry |
ZGPAT-169HCL | Recombinant Human ZGPAT 293 Cell Lysate | +Inquiry |
NCAPH-3954HCL | Recombinant Human NCAPH 293 Cell Lysate | +Inquiry |
NPEPL1-3744HCL | Recombinant Human NPEPL1 293 Cell Lysate | +Inquiry |
WDR55-340HCL | Recombinant Human WDR55 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MT-CO2 Products
Required fields are marked with *
My Review for All MT-CO2 Products
Required fields are marked with *
0
Inquiry Basket