Recombinant Full Length Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL21462MF |
Product Overview : | Recombinant Full Length Structural polyprotein Protein (Q80S27) (820-1258aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Middelburg virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (820-1258) |
Form : | Lyophilized powder |
AA Sequence : | YEHSVTLPNAVGFPYRAHVDRPGFSPLTLHMEVVSTSLEPTLALDYVTCEYKTVVPSPKV TCCGMSECAHQQKADFQCKVYTGVYPFLWGGAYCFCDSENTQLSEAYVERSEVCKHDHAA AYRAHTAALKAKISVTYGSTNGTAEAFVNGESTARIGDLKMILGPISTAWSPFDPKIVVY KDEVYNQDYPPYGSGQPGRFGDLQSRTTESNDVYANTALKLARPSAGTVHVPYTQTPSGF KYWLKEKGDALNHKAPFGCIIKTNPVRAENCAVGNIPVSLDIPDAAFTRIVDAPSLTGLK CEVATCTHSSDFGGTLVVEYKTDKVGTCAVHSESNTAVMQETSLSVTMDGRGTLHFSTAS ASPSFVLKVCSSKTTCTAKCVPPKDHVVPFPANHNNVVFPDFSSTAVSWLTHTMGGATVV IAIGITIFLIVTCIAFSRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | Q80S27 |
◆ Recombinant Proteins | ||
PLEKHF1-12952M | Recombinant Mouse PLEKHF1 Protein | +Inquiry |
NKX2-5-1742HFL | Recombinant Full Length Human NKX2-5 Protein, C-Flag-tagged | +Inquiry |
MIS12-3899H | Recombinant Human MIS12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NLRX1-4001R | Recombinant Rat NLRX1 Protein | +Inquiry |
MUT-3549H | Recombinant Human MUT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-325H | Native Human Collagen Type I | +Inquiry |
CHC-001C | Native Clostridium Histolyticum Collagenase, Tag Free | +Inquiry |
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
CVF-01I | Native purified cobra venom factor | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
Blood-601R | Rat Blood Lysate, Total Protein | +Inquiry |
EPHA3-1218HCL | Recombinant Human EPHA3 cell lysate | +Inquiry |
S100A3-2090HCL | Recombinant Human S100A3 293 Cell Lysate | +Inquiry |
WFDC2-2056HCL | Recombinant Human WFDC2 cell lysate | +Inquiry |
A4GALT-9163HCL | Recombinant Human A4GALT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Structural polyprotein Products
Required fields are marked with *
My Review for All Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket