Recombinant Full Length Streptococcus Pneumoniae Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged
Cat.No. : | RFL18605SF |
Product Overview : | Recombinant Full Length Streptococcus pneumoniae Glycerol-3-phosphate acyltransferase(plsY) Protein (C1CJU2) (1-213aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-213) |
Form : | Lyophilized powder |
AA Sequence : | MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTTNTFRILGKKAGMATFVID FFKGTLATLLPIIFHLQGVSPLIFGLLAVIGHTFPIFAGFKGGKAVATSAGVIFGFAPIF CLYLAIIFFGALYLGSMISLSSVTASIAAVIGVLLFPLFGFILSNYDSLFIAIILALASL IIIRHKDNIARIKNKTENLVPWGLNLTHQDPKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | plsY |
Synonyms | plsY; SPP_0859; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase |
UniProt ID | C1CJU2 |
◆ Recombinant Proteins | ||
PIM2-29589TH | Recombinant Human PIM2 | +Inquiry |
RFL33880RF | Recombinant Full Length Rat Mitochondrial Uncoupling Protein 2(Ucp2) Protein, His-Tagged | +Inquiry |
PIGR-8496Z | Recombinant Zebrafish PIGR | +Inquiry |
SMNDC1-31197TH | Recombinant Human SMNDC1, His-tagged | +Inquiry |
MRPL13-10045M | Recombinant Mouse MRPL13 Protein | +Inquiry |
◆ Native Proteins | ||
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
Fgg -69R | Native Rat Fibrinogen | +Inquiry |
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA12-3061HCL | Recombinant Human CA12 cell lysate | +Inquiry |
GALNT2-907HCL | Recombinant Human GALNT2 cell lysate | +Inquiry |
RHEBL1-2357HCL | Recombinant Human RHEBL1 293 Cell Lysate | +Inquiry |
NDUFB5-3904HCL | Recombinant Human NDUFB5 293 Cell Lysate | +Inquiry |
CADM3-738RCL | Recombinant Rat CADM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All plsY Products
Required fields are marked with *
My Review for All plsY Products
Required fields are marked with *
0
Inquiry Basket