Recombinant Full Length Streptococcus Pneumoniae Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged
Cat.No. : | RFL35104SF |
Product Overview : | Recombinant Full Length Streptococcus pneumoniae Glycerol-3-phosphate acyltransferase(plsY) Protein (P0A4Q0) (1-213aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-213) |
Form : | Lyophilized powder |
AA Sequence : | MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTTNTFRILGKKAGMATFVID FFKGTLATLLPIIFHLQGVSPLIFGLLAVIGHTFPIFAGFKGGKAVATSAGVIFGFAPIF CLYLAIIFFGALYLGSMISLSSVTASIAAVIGVLLFPLFGFILSNYDSLFIAIILALASL IIIRHKDNIARIKNKTENLVPWGLNLTHQDPKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | plsY |
Synonyms | plsY; spr0755; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase |
UniProt ID | P0A4Q0 |
◆ Recombinant Proteins | ||
ADAMTSL1-3833H | Recombinant Human ADAMTSL1 protein, His-tagged | +Inquiry |
ADAMTS1-2423H | Recombinant Human ADAMTS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9891SF | Recombinant Full Length Streptococcus Gordonii Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
IFNA4-597H | Active Recombinant Human IFNA4 | +Inquiry |
RFL22674OF | Recombinant Full Length Oenothera Parviflora Photosystem Q(B) Protein Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGB-31B | Native Bovine Fibrinogen | +Inquiry |
AsAGP-002B | Native Bovine Asialo-a1-acid glycoprotein Protein | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
Lectin-1761A | Active Native Agaricus bisporus lectin Protein, Fluorescein labeled | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP7-352HCL | Recombinant Human CHMP7 cell lysate | +Inquiry |
Colon-97R | Rhesus monkey Colon transverse Lysate | +Inquiry |
LILRA3-1349HCL | Recombinant Human LILRA3 cell lysate | +Inquiry |
SMARCAD1-1670HCL | Recombinant Human SMARCAD1 293 Cell Lysate | +Inquiry |
SIRP-BETA-1753MCL | Recombinant Mouse SIRP-BETA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All plsY Products
Required fields are marked with *
My Review for All plsY Products
Required fields are marked with *
0
Inquiry Basket