Recombinant Full Length Staphylococcus Haemolyticus Probable Quinol Oxidase Subunit 2(Qoxa) Protein, His-Tagged
Cat.No. : | RFL6980SF |
Product Overview : | Recombinant Full Length Staphylococcus haemolyticus Probable quinol oxidase subunit 2(qoxA) Protein (Q4L565) (20-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Haemolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-374) |
Form : | Lyophilized powder |
AA Sequence : | CSNVEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLTMFAIFIFKYSYNKNSETGKMHHN SLIETIWFVVPIIIVIALSIPTVKTLYDYEKPPESKEDPMVVYAVSAGYKWFFAYPEQKV ETVNTLTIPKNRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLQADETGTFRGRN SNFNGEGFSRQTFKVHSVDQSEFDSWVKDAKSKKTLSQDEFDKQLLPSTPNKELTFSGTH MAFVDPAADPEYIFYAYKRYNYVQKDPNFVAEKDLYKDVTDKPQKPARKVQITNANYKRH GMKPMILGNNDPYDNEFKKEEDHNSKEMEKISKSAKDENASKFGSKADNDHGGGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qoxA |
Synonyms | qoxA; SH1901; Probable quinol oxidase subunit 2; Quinol oxidase polypeptide II |
UniProt ID | Q4L565 |
◆ Recombinant Proteins | ||
DHX15-2300H | Recombinant Human DHX15 Protein, MYC/DDK-tagged | +Inquiry |
RFL33441MF | Recombinant Full Length Methylobacillus Flagellatus Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
Wnt3a-526M | Active Recombinant Murine Wnt3a protein | +Inquiry |
MOXD1L-6915Z | Recombinant Zebrafish MOXD1L | +Inquiry |
CHM-1919H | Recombinant Human CHM Protein (1-653 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
PROC-269B | Active Native Bovine Protein C | +Inquiry |
PGK-100Y | Active Native Yeast 3-Phosphoglyceric Phosphokinase | +Inquiry |
LDL-402H | Native Human Low Density Lipoprotein, High Oxidized, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBP1-6316HCL | Recombinant Human FBP1 293 Cell Lysate | +Inquiry |
SPATA33-8252HCL | Recombinant Human C16orf55 293 Cell Lysate | +Inquiry |
CHST8-7505HCL | Recombinant Human CHST8 293 Cell Lysate | +Inquiry |
TRIM16-1822HCL | Recombinant Human TRIM16 cell lysate | +Inquiry |
HA-010H7N9CL | Recombinant H7N9 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All qoxA Products
Required fields are marked with *
My Review for All qoxA Products
Required fields are marked with *
0
Inquiry Basket