Recombinant Full Length Staphylococcus Haemolyticus Probable Ctpa-Like Serine Protease(Sh1486) Protein, His-Tagged
Cat.No. : | RFL6608SF |
Product Overview : | Recombinant Full Length Staphylococcus haemolyticus Probable CtpA-like serine protease(SH1486) Protein (Q4L6D0) (1-496aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Haemolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-496) |
Form : | Lyophilized powder |
AA Sequence : | MRKCFFMSHNPEEKQSNLDSNHKNESSSNKRIKFKTWQFILLLLGVVIITAGITVAATIG ISHKISGLTKDERQEIKKIEYAYKTLNNDYYKKQNAGKLSEAAIDGMVKELKDPYSEYMT KDETKSFNEDVSGDFVGIGAEMQKKDKQIMITSPMKDSPAEKAGIQPKDVVTKVDGKSVV GKPLDQVVKLVRGKEGTTVKLTIKRGSQEKEIKIKRGKIHVKSVEYKKKDNIGVFTINKF QDNTAGELKSAIIKAHKDGVRSIVLDLRNNPGGLLDEAVKMANIFIDKDQTVVKLEKGDD TESIKTSNDASNEAKDMKVSILVNEGSASASEVFTGAMRDHKKAKVYGSKTFGKGIVQTT REFKDGSLLKYTQMKWLTPDGHNIHGKGIQPDTKIASPQYQSISVIPTDKSYSVGDNTKY VKSIKIGLDALGYNVNNDSKQFDTQLESAIKKFQSEHELSVNGKFDKKTNEKFTQLLVEK ANKEDKVLDELINKLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SH1486 |
Synonyms | SH1486; Probable CtpA-like serine protease |
UniProt ID | Q4L6D0 |
◆ Recombinant Proteins | ||
PDXK-5350C | Recombinant Chicken PDXK | +Inquiry |
DLGAP1A-7977Z | Recombinant Zebrafish DLGAP1A | +Inquiry |
RFL27834XF | Recombinant Full Length Xenopus Laevis Transmembrane Protein 135(Tmem135) Protein, His-Tagged | +Inquiry |
SOCS5B-6374Z | Recombinant Zebrafish SOCS5B | +Inquiry |
C1QTNF6-27143TH | Recombinant Human C1QTNF6, FLAG-tagged | +Inquiry |
◆ Native Proteins | ||
S100A1B-9H | Native Human S100A1B | +Inquiry |
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
CRP-5330H | Native Canine CRP protein | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K2-613HCL | Recombinant Human MAP2K2 cell lysate | +Inquiry |
CD200R1-2523HCL | Recombinant Human CD200R1 cell lysate | +Inquiry |
ACAP2-9109HCL | Recombinant Human ACAP2 293 Cell Lysate | +Inquiry |
AGXT2L1-8966HCL | Recombinant Human AGXT2L1 293 Cell Lysate | +Inquiry |
LHX2-4751HCL | Recombinant Human LHX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SH1486 Products
Required fields are marked with *
My Review for All SH1486 Products
Required fields are marked with *
0
Inquiry Basket