Recombinant Full Length Staphylococcus Haemolyticus Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL5215SF |
Product Overview : | Recombinant Full Length Staphylococcus haemolyticus Lipoteichoic acid synthase(ltaS) Protein (Q4L4D7) (218-645aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Haemolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-645) |
Form : | Lyophilized powder |
AA Sequence : | SEDDLTKVLNYTKQKNTTPNSEYFGAAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSTGNEDFRYYPNFFHQTGQGKTSDAEFTMDNSLYGLPQGSAYSLKGDNTYQSLPAILDQ KQGYTSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDDNIVNLGLKDKPFFKESAE YQSKMKGPFYSHLITLTNHYPFTLSEEDADIDKPNTGDSTVDGYIQTAHYLDQALEEYVT DLKKKGLYDDSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFMDLNRTGFWLKIPGKEG TVDKTYAGQMDVMPTILHLVGIDSKNFLMFGTDMLSKDHNDVIPFRNGDFITKDYKYVNG KAYSNKTNELLETQPKDLDKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKIDPSKYEYK TGPKGNQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; SH2179; Lipoteichoic acid synthase |
UniProt ID | Q4L4D7 |
◆ Recombinant Proteins | ||
NRAP-4298Z | Recombinant Zebrafish NRAP | +Inquiry |
RFL26314NF | Recombinant Full Length Neisseria Gonorrhoeae Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
PDCD1LG2-828HB | Active Recombinant Human PDCD1LG2 protein, His-tagged, Biotinylated | +Inquiry |
TRPM8-1170HFL | Recombinant Human TRPM8 protein, His&Flag-tagged | +Inquiry |
RPL4-3992R | Recombinant Rhesus monkey RPL4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
NEFM-1520B | Native Bovine NEFM | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAD2L1BP-4569HCL | Recombinant Human MAD2L1BP 293 Cell Lysate | +Inquiry |
HCFC1R1-5613HCL | Recombinant Human HCFC1R1 293 Cell Lysate | +Inquiry |
HECTD3-5590HCL | Recombinant Human HECTD3 293 Cell Lysate | +Inquiry |
WHSC1-1931HCL | Recombinant Human WHSC1 cell lysate | +Inquiry |
Parathyroid-372C | Cynomolgus monkey Parathyroid Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket