Recombinant Full Length Staphylococcus Epidermidis Sensor Protein Vras(Vras) Protein, His-Tagged
Cat.No. : | RFL155SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Sensor protein vraS(vraS) Protein (Q8CRV2) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-348) |
Form : | Lyophilized powder |
AA Sequence : | MNHYIRAIGSMLILVYSMLIAFLFIDKVFVNIIFFQGMFYTQIFGIPVFLFLNLLIVLLC IIVGSVLAYKINQQNDWIISQIERSIEGQTVGINDQNIELYTETIDIYHTLVPLNQELHR LRMKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKESKLEP PLNQQIPILEKMVQDSQLEMRALLLHLRPIGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFEVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNQEDYLLLRIQDNGKGFNVDEK FEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEENSSGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vraS |
Synonyms | vraS; SE_1570; Sensor protein VraS |
UniProt ID | Q8CRV2 |
◆ Recombinant Proteins | ||
MAPK14-382H | Recombinant Human MAPK14 Protein, MYC/DDK-tagged | +Inquiry |
MCM8-3275R | Recombinant Rat MCM8 Protein, His (Fc)-Avi-tagged | +Inquiry |
EYA4-3595H | Recombinant Human EYA4 Protein, GST-tagged | +Inquiry |
BDBA-1087B | Recombinant Bacillus subtilis BDBA protein, His-tagged | +Inquiry |
Cntn4-880M | Recombinant Mouse Cntn4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VTN -33B | Native Bovine multimeric vitronectin | +Inquiry |
PLG-268B | Active Native Bovine glu-Plasminogen | +Inquiry |
PGK-100Y | Active Native Yeast 3-Phosphoglyceric Phosphokinase | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
EDN2-8310H | Native Human EDN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
REV1-2414HCL | Recombinant Human REV1 293 Cell Lysate | +Inquiry |
SLC16A14-1800HCL | Recombinant Human SLC16A14 293 Cell Lysate | +Inquiry |
ACTRT1-9045HCL | Recombinant Human ACTRT1 293 Cell Lysate | +Inquiry |
Fetus-182R | Rat Fetus (11 Day Fetus) Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vraS Products
Required fields are marked with *
My Review for All vraS Products
Required fields are marked with *
0
Inquiry Basket