Recombinant Full Length Staphylococcus Epidermidis Sensor Protein Vras(Vras) Protein, His-Tagged
Cat.No. : | RFL11464SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Sensor protein vraS(vraS) Protein (Q5HN49) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-348) |
Form : | Lyophilized powder |
AA Sequence : | MNHYIRAIGSMLILVYSMLIAFLFIDKVFVNIIFFQGMFYTQIFGIPVFLFLNLLIVLLC IIVGSVLAYKINQQNDWIISQIERSIEGQTVGINDQNIELYTETIDIYHTLVPLNQELHR LRMKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKESKLEP PLNQQIPILEKMVQDSQLEMRALLLHLRPIGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFEVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNQEDYLLLRIQDNGKGFNVDEK FEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEENSSGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vraS |
Synonyms | vraS; SERP1423; Sensor protein VraS |
UniProt ID | Q5HN49 |
◆ Recombinant Proteins | ||
RPS11-2413H | Recombinant Human RPS11, His-tagged | +Inquiry |
ADAMTS18-2422H | Recombinant Human ADAMTS18 protein, His-tagged | +Inquiry |
GUCY2D-1033H | Recombinant Human GUCY2D Protein, His (Fc)-Avi-tagged | +Inquiry |
RAC2-295Z | Recombinant Zebrafish RAC2 | +Inquiry |
YWFL-0405B | Recombinant Bacillus subtilis YWFL protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MG-41H | Active Native Human MG | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
HPX-207H | Native Human Hemopexin | +Inquiry |
TNNI3-223H | Native Human Troponin I Type 3 (Cardiac) | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFAP44-342HCL | Recombinant Human WDR52 293 Cell Lysate | +Inquiry |
LEPRE1-4772HCL | Recombinant Human LEPRE1 293 Cell Lysate | +Inquiry |
CCNE2-7709HCL | Recombinant Human CCNE2 293 Cell Lysate | +Inquiry |
QKI-2640HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
RGS11-1500HCL | Recombinant Human RGS11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All vraS Products
Required fields are marked with *
My Review for All vraS Products
Required fields are marked with *
0
Inquiry Basket