Recombinant Full Length Staphylococcus Epidermidis Phosphatidate Cytidylyltransferase(Cdsa) Protein, His-Tagged
Cat.No. : | RFL29359SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Phosphatidate cytidylyltransferase(cdsA) Protein (Q5HPT0) (1-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-260) |
Form : | Lyophilized powder |
AA Sequence : | MKVRTLTAIIALLIFLPILLKGGLILMLFAFLLALIALKELLNMNMIKFLSIPGLISALA LIIIMLPQDAGEWVQVIQLKGLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM YFYETRSEGLRYILFAFLIVWLTDTGAYIFGRLMGKHKLWPVISPNKTIEGFFGGILCSI LVPLVMQMFVDLHMNIWLLLLVTIVLSMFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL DRFDSFMFVLPLLNILLIQT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cdsA |
Synonyms | cdsA; SERP0828; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase |
UniProt ID | Q5HPT0 |
◆ Recombinant Proteins | ||
JUNB-3147R | Recombinant Rat JUNB Protein | +Inquiry |
RFL26135MF | Recombinant Full Length Macropus Robustus Cytochrome C Oxidase Subunit 3(Mt-Co3) Protein, His-Tagged | +Inquiry |
GFM1-977H | Recombinant Human GFM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
INPP5A-013H | Recombinant Human INPP5A Protein, His-tagged | +Inquiry |
ZXDB-19259M | Recombinant Mouse ZXDB Protein | +Inquiry |
◆ Native Proteins | ||
MBP-89S | Native Swine MBP Protein | +Inquiry |
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
IgM-208M | Native Monkey Immunoglobulin M | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf10-8330HCL | Recombinant Human C12orf10 293 Cell Lysate | +Inquiry |
AMPK-410HCL | Recombinant Human AMPK cell lysate | +Inquiry |
ST3GAL5-1440HCL | Recombinant Human ST3GAL5 293 Cell Lysate | +Inquiry |
ESR2-6539HCL | Recombinant Human ESR2 293 Cell Lysate | +Inquiry |
PVRL2-1403RCL | Recombinant Rat PVRL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cdsA Products
Required fields are marked with *
My Review for All cdsA Products
Required fields are marked with *
0
Inquiry Basket