Recombinant Full Length Staphylococcus Aureus Upf0754 Membrane Protein Saurjh9_1899 (Saurjh9_1899) Protein, His-Tagged
Cat.No. : | RFL24430SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0754 membrane protein SaurJH9_1899 (SaurJH9_1899) Protein (A5IU11) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLDQHVDNATDLLCDRARNYLSSAK GTQDINDMLDTFFHEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASNQANKPVVTLMPQFVDYLEGQLSSKL ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG GIIGFFQGLVAIFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SaurJH9_1899 |
Synonyms | SaurJH9_1899; UPF0754 membrane protein SaurJH9_1899 |
UniProt ID | A5IU11 |
◆ Native Proteins | ||
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
Collagen-46M | Native Mouse Collagen protein | +Inquiry |
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
Fxa-283B | Active Native Bovine Factor Xa - DEGR | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
B4GALT3-8538HCL | Recombinant Human B4GALT3 293 Cell Lysate | +Inquiry |
MLLT1-1117HCL | Recombinant Human MLLT1 cell lysate | +Inquiry |
FNDC9-1093HCL | Recombinant Human FNDC9 cell lysate | +Inquiry |
FAM20B-001HCL | Recombinant Human FAM20B cell lysate | +Inquiry |
CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SaurJH9_1899 Products
Required fields are marked with *
My Review for All SaurJH9_1899 Products
Required fields are marked with *
0
Inquiry Basket