Recombinant Full Length Staphylococcus Aureus Upf0754 Membrane Protein Saurjh1_1933 (Saurjh1_1933) Protein, His-Tagged
Cat.No. : | RFL7045SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0754 membrane protein SaurJH1_1933 (SaurJH1_1933) Protein (A6U2U9) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLDQHVDNATDLLCDRARNYLSSAK GTQDINDMLDTFFHEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASNQANKPVVTLMPQFVDYLEGQLSSKL ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG GIIGFFQGLVAIFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SaurJH1_1933 |
Synonyms | SaurJH1_1933; UPF0754 membrane protein SaurJH1_1933 |
UniProt ID | A6U2U9 |
◆ Recombinant Proteins | ||
CCDC142-2844M | Recombinant Mouse CCDC142 Protein | +Inquiry |
Ptpn13-8098M | Recombinant Mouse Ptpn13 protein, His & T7-tagged | +Inquiry |
RFL34965MF | Recombinant Full Length Myxococcus Xanthus Type 4 Prepilin-Like Proteins Leader Peptide-Processing Enzyme(Pild) Protein, His-Tagged | +Inquiry |
SOGA3-4101H | Recombinant Human SOGA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP14-162H | Active Recombinant Human MMP14 | +Inquiry |
◆ Native Proteins | ||
Mucin-232P | Native Porcine Mucin | +Inquiry |
Thrombin-21H | Active Native Cattle Thrombin | +Inquiry |
C3-365H | Active Native Human C3 Protein | +Inquiry |
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
Proteoglycans-52H | Native Human Proteoglycans | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCBLD2-868HCL | Recombinant Human DCBLD2 cell lysate | +Inquiry |
RPL12-2227HCL | Recombinant Human RPL12 293 Cell Lysate | +Inquiry |
ONECUT1-3576HCL | Recombinant Human ONECUT1 293 Cell Lysate | +Inquiry |
PTP4A2-2694HCL | Recombinant Human PTP4A2 293 Cell Lysate | +Inquiry |
IL35-2904HCL | Recombinant Human IL35 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SaurJH1_1933 Products
Required fields are marked with *
My Review for All SaurJH1_1933 Products
Required fields are marked with *
0
Inquiry Basket