Recombinant Full Length Staphylococcus Aureus Upf0397 Protein Usa300Hou_2687 (Usa300Hou_2687) Protein, His-Tagged
Cat.No. : | RFL18378SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0397 protein USA300HOU_2687 (USA300HOU_2687) Protein (A8Z5I6) (1-184aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-184) |
Form : | Lyophilized powder |
AA Sequence : | MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQII ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS LRKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | USA300HOU_2687 |
Synonyms | USA300HOU_2687; UPF0397 protein USA300HOU_2687 |
UniProt ID | A8Z5I6 |
◆ Native Proteins | ||
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
MMP9-40H | Native Human MMP-9/Lipocalin/TIMP-1 Complex | +Inquiry |
Blood-011H | Human Blood Lysate, Total Protein | +Inquiry |
TF-31158TH | Native Human TF | +Inquiry |
◆ Cell & Tissue Lysates | ||
DVL2-6765HCL | Recombinant Human DVL2 293 Cell Lysate | +Inquiry |
TMEM42-1793HCL | Recombinant Human TMEM42 cell lysate | +Inquiry |
SASS6-1562HCL | Recombinant Human SASS6 cell lysate | +Inquiry |
KRT17-953HCL | Recombinant Human KRT17 cell lysate | +Inquiry |
TSPAN13-713HCL | Recombinant Human TSPAN13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USA300HOU_2687 Products
Required fields are marked with *
My Review for All USA300HOU_2687 Products
Required fields are marked with *
0
Inquiry Basket