Recombinant Full Length Staphylococcus Aureus Upf0365 Protein Sausa300_1533(Sausa300_1533) Protein, His-Tagged
Cat.No. : | RFL23551SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0365 protein SAUSA300_1533(SAUSA300_1533) Protein (Q2FGF0) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAUSA300_1533 |
Synonyms | floA; SAUSA300_1533; Flotillin-like protein FloA |
UniProt ID | Q2FGF0 |
◆ Recombinant Proteins | ||
GPI-2883H | Recombinant Human Full length GPI protein(1-558 aa), C-His-tagged | +Inquiry |
SUJ-0003P2-2435S | Recombinant Staphylococcus aureus (strain: 18810) SUJ_0003P2 protein, His-tagged | +Inquiry |
FAM187B-3727H | Recombinant Human FAM187B Protein | +Inquiry |
IL6R-239H | Recombinant Human IL6R, C13&N15-labeled | +Inquiry |
STAT4-3231H | Recombinant Human STAT4 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-27925TH | Native Human PLG | +Inquiry |
VTN-386R | Native Rabbit Vitronectin | +Inquiry |
Collagen Type I-48H | Native Human tendon collagen type I | +Inquiry |
HSV2Ag-355H | Active Native Herpes Simplex Virus 2 Protein | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALG9-8904HCL | Recombinant Human ALG9 293 Cell Lysate | +Inquiry |
Heart-95M | Mouse Heart Tissue Lysate | +Inquiry |
CMKLR1-189HCL | Recombinant Human CMKLR1 lysate | +Inquiry |
EIF2AK3-6673HCL | Recombinant Human EIF2AK3 293 Cell Lysate | +Inquiry |
MRI1-4202HCL | Recombinant Human MRI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAUSA300_1533 Products
Required fields are marked with *
My Review for All SAUSA300_1533 Products
Required fields are marked with *
0
Inquiry Basket