Recombinant Full Length Staphylococcus Aureus Uncharacterized Sensor-Like Histidine Kinase Sar0215(Sar0215) Protein, His-Tagged
Cat.No. : | RFL479SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Uncharacterized sensor-like histidine kinase SAR0215(SAR0215) Protein (Q6GK92) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYIANTPRLSEIKKDSRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAR0215 |
Synonyms | hptS; SAR0215; Sensor protein kinase HptS |
UniProt ID | Q6GK92 |
◆ Recombinant Proteins | ||
CRBN-1962M | Recombinant Mouse CRBN Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA7-5703H | Recombinant Human SERPINA7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDHA1-4853H | Recombinant Human PDHA1 Protein (Phe30-Ser390), N-His tagged | +Inquiry |
ING5-2091R | Recombinant Rhesus Macaque ING5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTNNA1-2055M | Recombinant Mouse CTNNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ELANE-27537TH | Native Human ELANE | +Inquiry |
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
Collagen Type I & III-07P | Native Porcine Collagen Type I and III Protein | +Inquiry |
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEK6-3877HCL | Recombinant Human NEK6 293 Cell Lysate | +Inquiry |
TINAGL1-1061HCL | Recombinant Human TINAGL1 293 Cell Lysate | +Inquiry |
C9orf169-7938HCL | Recombinant Human C9orf169 293 Cell Lysate | +Inquiry |
NPAS2-1208HCL | Recombinant Human NPAS2 cell lysate | +Inquiry |
TXNDC5-622HCL | Recombinant Human TXNDC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAR0215 Products
Required fields are marked with *
My Review for All SAR0215 Products
Required fields are marked with *
0
Inquiry Basket