Recombinant Full Length Staphylococcus Aureus Uncharacterized Membrane Protein Sa0701(Sa0701) Protein, His-Tagged
Cat.No. : | RFL35554SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Uncharacterized membrane protein SA0701(SA0701) Protein (Q99VM8) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SA0701 |
Synonyms | SA0701; Uncharacterized membrane protein SA0701 |
UniProt ID | Q99VM8 |
◆ Recombinant Proteins | ||
IL7-069H | Active Recombinant Human IL7 Protein | +Inquiry |
TET2-311H | Recombinant Human TET2 protein, His-tagged | +Inquiry |
TNF-249H | Active Recombinant Human TNF Protein | +Inquiry |
FGF10-5387C | Recombinant Cynomolgus monkey FGF10 Protein (His29-Ser209), C-His tagged | +Inquiry |
RPL10-4766R | Recombinant Rat RPL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
IgG-166R | Native Rat IgG Fc fragment | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM183A-679HCL | Recombinant Human TMEM183A lysate | +Inquiry |
SIRPG-1079CCL | Recombinant Cynomolgus SIRPG cell lysate | +Inquiry |
LXN-2898HCL | Recombinant Human LXN cell lysate | +Inquiry |
MMP20-4276HCL | Recombinant Human MMP20 293 Cell Lysate | +Inquiry |
UBE2V1-560HCL | Recombinant Human UBE2V1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SA0701 Products
Required fields are marked with *
My Review for All SA0701 Products
Required fields are marked with *
0
Inquiry Basket