Recombinant Full Length Staphylococcus Aureus Sensor Protein Vras(Vras) Protein, His-Tagged
Cat.No. : | RFL27944SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Sensor protein vraS(vraS) Protein (Q7A0H9) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vraS |
Synonyms | vraS; MW1825; Sensor protein VraS |
UniProt ID | Q7A0H9 |
◆ Recombinant Proteins | ||
SCO5319-951S | Recombinant Streptomyces coelicolor A3(2) SCO5319 protein, His-tagged | +Inquiry |
RFL4825BF | Recombinant Full Length Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
RBM20-13996M | Recombinant Mouse RBM20 Protein | +Inquiry |
ENPP2-03H | Recombinant Human ENPP2 protein, His-tagged | +Inquiry |
RFL18962SF | Recombinant Full Length Solanum Lycopersicum Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGB-6H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
Pzp-3279H | Native Human Pzp | +Inquiry |
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
Protein A-01S | Active Native Staphylococcus aureus Protein A | +Inquiry |
PGI-241H | Native Human Pepsinogen I | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMRN1-4272HCL | Recombinant Human MMRN1 293 Cell Lysate | +Inquiry |
NT5C2-3677HCL | Recombinant Human NT5C2 293 Cell Lysate | +Inquiry |
COX19-7335HCL | Recombinant Human COX19 293 Cell Lysate | +Inquiry |
FUT2-6115HCL | Recombinant Human FUT2 293 Cell Lysate | +Inquiry |
Heart-137R | Rat Heart Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vraS Products
Required fields are marked with *
My Review for All vraS Products
Required fields are marked with *
0
Inquiry Basket