Recombinant Full Length Staphylococcus Aureus Sensor Protein Vras(Vras) Protein, His-Tagged
Cat.No. : | RFL19454SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Sensor protein vraS(vraS) Protein (Q7A2Q0) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MNHYNRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vraS |
Synonyms | vraS; SAV1885; Sensor protein VraS |
UniProt ID | Q7A2Q0 |
◆ Recombinant Proteins | ||
CD63-3112H | Recombinant Human CD63 Protein, MYC/DDK-tagged | +Inquiry |
CCNB1-2959HF | Recombinant Full Length Human CCNB1 Protein, GST-tagged | +Inquiry |
CD300E-697H | Recombinant Human CD300E protein, hFc-tagged | +Inquiry |
BST2-8454H | Recombinant Human BST2 protein, hFc-tagged | +Inquiry |
EIF2B5-2049R | Recombinant Rat EIF2B5 Protein | +Inquiry |
◆ Native Proteins | ||
NEFM-179B | Native bovine NEFM | +Inquiry |
CSH1-31024TH | Native Human CSH1 | +Inquiry |
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
Collagen-62B | Native Bovine Collagen Type XI | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPX-2789HCL | Recombinant Human HPX cell lysate | +Inquiry |
SERPINF1-2500HCL | Recombinant Human SERPINF1 cell lysate | +Inquiry |
UBE2G2-578HCL | Recombinant Human UBE2G2 293 Cell Lysate | +Inquiry |
C7orf61-7958HCL | Recombinant Human C7orf61 293 Cell Lysate | +Inquiry |
SPC25-1527HCL | Recombinant Human SPC25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vraS Products
Required fields are marked with *
My Review for All vraS Products
Required fields are marked with *
0
Inquiry Basket