Recombinant Full Length Staphylococcus Aureus Putative Multidrug Export Atp-Binding/Permease Protein Sacol1924(Sacol1924) Protein, His-Tagged
Cat.No. : | RFL11970SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Putative multidrug export ATP-binding/permease protein SACOL1924(SACOL1924) Protein (Q5HEQ8) (1-578aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-578) |
Form : | Lyophilized powder |
AA Sequence : | MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SACOL1924 |
Synonyms | SACOL1924; Putative multidrug export ATP-binding/permease protein SACOL1924 |
UniProt ID | Q5HEQ8 |
◆ Recombinant Proteins | ||
UGDH-3266H | Recombinant Human UGDH protein, His-tagged | +Inquiry |
MMP1-5412H | Active Recombinant Human MMP1 Protein | +Inquiry |
Nog-28M | Recombinant Mouse/Rat Nog Protein | +Inquiry |
MASP2-1451H | Recombinant Human MASP2 protein, His-tagged | +Inquiry |
RFL5603SF | Recombinant Full Length Staphylococcus Aureus Upf0397 Protein Sa2477(Sa2477) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
AMY2-5364P | Native Pig Amylase, Alpha 2B (pancreatic) | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP1A2-8612HCL | Recombinant Human ATP1A2 293 Cell Lysate | +Inquiry |
Bone-37H | Human Bone Cytoplasmic Tumor Lysate | +Inquiry |
SNPH-1627HCL | Recombinant Human SNPH 293 Cell Lysate | +Inquiry |
FOXA1-6164HCL | Recombinant Human FOXA1 293 Cell Lysate | +Inquiry |
WDR44-347HCL | Recombinant Human WDR44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SACOL1924 Products
Required fields are marked with *
My Review for All SACOL1924 Products
Required fields are marked with *
0
Inquiry Basket