Recombinant Full Length Staphylococcus Aureus Protein Flp(Flp) Protein, His-Tagged
Cat.No. : | RFL34019SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Protein flp(flp) Protein (Q5HDB2) (1-498aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-498) |
Form : | Lyophilized powder |
AA Sequence : | MTTKKLYFLSISIIIIVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTRAIMGDEL HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNYKSKHDA IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK LVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL LRRSKRIAVLSWLSLCICIALALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL FSTLIVILLFLHTKITKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flp |
Synonyms | flp; SACOL2445; Protein flp; FmtA-like protein |
UniProt ID | Q5HDB2 |
◆ Recombinant Proteins | ||
GLIS1-5332HF | Recombinant Full Length Human GLIS1 Protein, GST-tagged | +Inquiry |
LBX1-3363R | Recombinant Rat LBX1 Protein | +Inquiry |
SH-RS05585-5650S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS05585 protein, His-tagged | +Inquiry |
INS-IGF2-5097H | Recombinant Human INS-IGF2 Protein, GST-tagged | +Inquiry |
KLK2-221H | Recombinant Human kallikrein-related peptidase 2, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-252H | Native Human Immunoglobulin A | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
KRT19-5H | Native Human CK19 | +Inquiry |
Peroxidase-32H | Active Native Horseradish Peroxidase | +Inquiry |
HSV-1ag-265V | Active Native HSV-1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRAMEF2-2893HCL | Recombinant Human PRAMEF2 293 Cell Lysate | +Inquiry |
HARBI1-5635HCL | Recombinant Human HARBI1 293 Cell Lysate | +Inquiry |
CD52-1436RCL | Recombinant Rat CD52 cell lysate | +Inquiry |
ARIH1-8726HCL | Recombinant Human ARIH1 293 Cell Lysate | +Inquiry |
A431-06HL | Human A431 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All flp Products
Required fields are marked with *
My Review for All flp Products
Required fields are marked with *
0
Inquiry Basket