Recombinant Full Length Staphylococcus Aureus Probable Quinol Oxidase Subunit 3(Qoxc) Protein, His-Tagged
Cat.No. : | RFL11118SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Probable quinol oxidase subunit 3(qoxC) Protein (Q6GAF4) (1-201aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-201) |
Form : | Lyophilized powder |
AA Sequence : | MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF LDVVWVFIFTAVYMIGMVYSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qoxC |
Synonyms | qoxC; SAS0994; Probable quinol oxidase subunit 3; Quinol oxidase polypeptide III |
UniProt ID | Q6GAF4 |
◆ Recombinant Proteins | ||
HNRNPA3-4386Z | Recombinant Zebrafish HNRNPA3 | +Inquiry |
SLC25A30-1014H | Recombinant Human SLC25A30 | +Inquiry |
CD226-635HF | Recombinant Human CD226 Protein, hFc-tagged, FITC conjugated | +Inquiry |
DBX1B-8786Z | Recombinant Zebrafish DBX1B | +Inquiry |
NGFR-6993H | Recombinant Human NGFR protein(Met1-Asn250), His-tagged | +Inquiry |
◆ Native Proteins | ||
LTF-230B | Native Bovine Apo-Lactoferrin | +Inquiry |
VTN-384B | Native Bovine Vitronectin | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
AMY1B-31376TH | Native Human AMY1B | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBY1-147HCL | Recombinant Human CBY1 lysate | +Inquiry |
CDCP1-1449MCL | Recombinant Mouse CDCP1 cell lysate | +Inquiry |
TMEM70-934HCL | Recombinant Human TMEM70 293 Cell Lysate | +Inquiry |
KIT-2114MCL | Recombinant Mouse KIT cell lysate | +Inquiry |
OCRL-3601HCL | Recombinant Human OCRL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All qoxC Products
Required fields are marked with *
My Review for All qoxC Products
Required fields are marked with *
0
Inquiry Basket