Recombinant Full Length Staphylococcus Aureus Poly-Beta-1,6-N-Acetyl-D-Glucosamine Synthase(Icaa) Protein, His-Tagged
Cat.No. : | RFL147SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase(icaA) Protein (Q6GDD8) (1-412aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-412) |
Form : | Lyophilized powder |
AA Sequence : | MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | icaA |
Synonyms | icaA; SAR2747; Poly-beta-1,6-N-acetyl-D-glucosamine synthase; PNAG synthase; Poly-beta-1,6-GlcNAc synthase; Biofilm polysaccharide intercellular adhesin synthesis protein IcaA; Biofilm PIA synthesis protein IcaA; Intercellular adhesion protein A; N-acetyl |
UniProt ID | Q6GDD8 |
◆ Recombinant Proteins | ||
KDR-1421H | Active Recombinant Human KDR, GST-tagged | +Inquiry |
HLA-DRB1-2946H | Recombinant Human HLA-DRB1 Protein (Gly30-Ser266), His tagged | +Inquiry |
ATP2B4-2945H | Recombinant Human ATP2B4 Protein, MYC/DDK-tagged | +Inquiry |
RFL2155AF | Recombinant Full Length Anas Platyrhynchos Nadh-Ubiquinone Oxidoreductase Chain 1(Mt-Nd1) Protein, His-Tagged | +Inquiry |
SHOC2-2663H | Recombinant Human SHOC2, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MMP2-29475TH | Native Human MMP2 | +Inquiry |
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
IgA-259H | Native Human Secretory Immunoglobulin A | +Inquiry |
IgG-355S | Native Sheep IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYCE1-644HCL | Recombinant Human SYCE1 lysate | +Inquiry |
ZMAT4-156HCL | Recombinant Human ZMAT4 293 Cell Lysate | +Inquiry |
ASNS-8650HCL | Recombinant Human ASNS 293 Cell Lysate | +Inquiry |
C10orf10-8377HCL | Recombinant Human C10orf10 293 Cell Lysate | +Inquiry |
SLCO1B1-1689HCL | Recombinant Human SLCO1B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All icaA Products
Required fields are marked with *
My Review for All icaA Products
Required fields are marked with *
0
Inquiry Basket