Recombinant Full Length Staphylococcus Aureus Na(+)/H(+) Antiporter Subunit E1(Mnhe1) Protein, His-Tagged
Cat.No. : | RFL21511SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Na(+)/H(+) antiporter subunit E1(mnhE1) Protein (Q2YWT8) (1-159aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-159) |
Form : | Lyophilized powder |
AA Sequence : | MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL IIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhE1 |
Synonyms | mnhE1; SAB0815c; Na(+/H(+ antiporter subunit E1; Mnh complex subunit E1 |
UniProt ID | Q2YWT8 |
◆ Recombinant Proteins | ||
MAP1LC3A-2660R | Recombinant Rhesus monkey MAP1LC3A Protein, His-tagged | +Inquiry |
SMPD4-2821H | Recombinant Human SMPD4, His-tagged | +Inquiry |
Lep-146M | Recombinant Mouse Leptin, PEG | +Inquiry |
HES1-2829R | Recombinant Rat HES1 Protein | +Inquiry |
RFL27201YF | Recombinant Full Length Yersinia Pestis Bv. Antiqua Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGG -41B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
DIS-2019 | Active Alpha-Cyclomaltodextrin glucanotransferase | +Inquiry |
AZU1-26565TH | Native Human AZU1 | +Inquiry |
Hb-197H | Native Human Hemoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53I11-859HCL | Recombinant Human TP53I11 293 Cell Lysate | +Inquiry |
NCKIPSD-1173HCL | Recombinant Human NCKIPSD cell lysate | +Inquiry |
SRGAP1-1691HCL | Recombinant Human SRGAP1 cell lysate | +Inquiry |
FAM119B-6443HCL | Recombinant Human FAM119B 293 Cell Lysate | +Inquiry |
TLK2-001HCL | Recombinant Human TLK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mnhE1 Products
Required fields are marked with *
My Review for All mnhE1 Products
Required fields are marked with *
0
Inquiry Basket