Recombinant Full Length Staphylococcus Aureus Monofunctional Glycosyltransferase(Mgt) Protein, His-Tagged
Cat.No. : | RFL16829SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Monofunctional glycosyltransferase(mgt) Protein (Q93Q23) (1-269aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-269) |
Form : | Lyophilized powder |
AA Sequence : | MKRSDRYSNSNEHFEHMKHEPHYNTYYQPVGKPPKKKKSKRILLKILLTILIIIALFIGI MYFLSTRDNVDELRKIENKSSFVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALF STISDRDVQGGSTITQQVVKNYFYDNDRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNI YFGDNQYTLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKVNAPSVYNINNMSENFTQ RVSTNLEKMKQQNYINETQYQQAMSQLNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mgt |
Synonyms | mgt; SAOUHSC_02012; Monofunctional glycosyltransferase; MGT; Peptidoglycan TGase |
UniProt ID | Q93Q23 |
◆ Native Proteins | ||
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
IgA-130H | Native Human Immunoglobulin A | +Inquiry |
CAT-101B | Active Native Bovine CAT | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-1588HCL | Recombinant H4N8 HA cell lysate | +Inquiry |
HRASLS-816HCL | Recombinant Human HRASLS cell lysate | +Inquiry |
IMPDH1-5212HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
Fetus-188M | Mouse Fetus (17 Day Fetus) Membrane Lysate | +Inquiry |
MS4A12-4128HCL | Recombinant Human MS4A12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mgt Products
Required fields are marked with *
My Review for All mgt Products
Required fields are marked with *
0
Inquiry Basket