Recombinant Full Length Staphylococcus Aureus Monofunctional Glycosyltransferase(Mgt) Protein, His-Tagged
Cat.No. : | RFL3616SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Monofunctional glycosyltransferase(mgt) Protein (Q5HEQ0) (1-269aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-269) |
Form : | Lyophilized powder |
AA Sequence : | MKRSDRYSNSNEHFEHMKHEPHYNTYYQPVGKPPKKKKSKRILLKILLTILIIIALFIGI MYFLSTRDNVDELRKIENKSSFVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALF STISDRDVQGGSTITQQVVKNYFYDNDRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNI YFGDNQYTLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKVNAPSVYNINNMSENFTQ RVSTNLEKMKQQNYINETQYQQAMSQLNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mgt |
Synonyms | mgt; SACOL1932; Monofunctional glycosyltransferase; MGT; Peptidoglycan TGase |
UniProt ID | Q5HEQ0 |
◆ Recombinant Proteins | ||
CDKN1D-8333Z | Recombinant Zebrafish CDKN1D | +Inquiry |
DCX-2419HF | Recombinant Full Length Human DCX Protein, GST-tagged | +Inquiry |
RFL27949MF | Recombinant Full Length Mouse Membrane-Spanning 4-Domains Subfamily A Member 15(Ms4A15) Protein, His-Tagged | +Inquiry |
SNX15-2090HFL | Recombinant Full Length Human SNX15 Protein, C-Flag-tagged | +Inquiry |
POU3F4-4246R | Recombinant Rat POU3F4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MUC1-376H | Active Native Human MUC1 | +Inquiry |
E2-01H | Native Human Estradiol (E2) | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLK2-536HCL | Recombinant Human DLK2 cell lysate | +Inquiry |
MIS18BP1-202HCL | Recombinant Human MIS18BP1 cell lysate | +Inquiry |
FBLN1-598HCL | Recombinant Human FBLN1 cell lysate | +Inquiry |
PIAS2-3203HCL | Recombinant Human PIAS2 293 Cell Lysate | +Inquiry |
KLHDC9-4916HCL | Recombinant Human KLHDC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mgt Products
Required fields are marked with *
My Review for All mgt Products
Required fields are marked with *
0
Inquiry Basket