Recombinant Full Length Staphylococcus Aureus Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL5469SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Lipoteichoic acid synthase(ltaS) Protein (Q5HHV4) (218-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-646) |
Form : | Lyophilized powder |
AA Sequence : | SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; SACOL0778; Lipoteichoic acid synthase |
UniProt ID | Q5HHV4 |
◆ Recombinant Proteins | ||
FAM3C-1433R | Recombinant Rhesus Macaque FAM3C Protein, His (Fc)-Avi-tagged | +Inquiry |
AATF-5447Z | Recombinant Zebrafish AATF | +Inquiry |
RFL32483BF | Recombinant Full Length Borrelia Burgdorferi Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
Itgal-7135R | Recombinant Rat Itgal protein, His & T7-tagged | +Inquiry |
CA2-144H | Recombinant Human Carbonic Anhydrase II | +Inquiry |
◆ Native Proteins | ||
Fixa-279B | Active Native Bovine Factor IXa - EGR | +Inquiry |
ALB-584P | Native Guinea Pig ALB protein | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
Ighg2b-162M | Native Mouse Immunoglobulin G2b | +Inquiry |
IgG-347G | Native Guinea Pig Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTN2-1518MCL | Recombinant Mouse CNTN2 cell lysate | +Inquiry |
COX19-7335HCL | Recombinant Human COX19 293 Cell Lysate | +Inquiry |
HA-002H1N1CL | Recombinant H1N1 HA cell lysate | +Inquiry |
LOC407835-391HCL | Recombinant Human LOC407835 lysate | +Inquiry |
Eye-537E | Equine Eye Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket