Recombinant Full Length Staphylococcus Aureus Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL32474SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Lipoteichoic acid synthase(ltaS) Protein (Q2FIS2) (218-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-646) |
Form : | Lyophilized powder |
AA Sequence : | SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; SAUSA300_0703; Lipoteichoic acid synthase |
UniProt ID | Q2FIS2 |
◆ Recombinant Proteins | ||
FARSB-3120M | Recombinant Mouse FARSB Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25031CF | Recombinant Full Length Metaxin-1 Homolog(Mtx-1) Protein, His-Tagged | +Inquiry |
RFL21158LF | Recombinant Full Length Listeria Monocytogenes Serotype 4B Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
CD276-5542C | Recombinant Chicken CD276 | +Inquiry |
ZNF705A-1833H | Recombinant Human ZNF705A | +Inquiry |
◆ Native Proteins | ||
Fibrinogen-69C | Active Native Canine Fibrinogen | +Inquiry |
CTSB-26408TH | Native Human CTSB | +Inquiry |
Immunoglobulin-5264B | Native Bovine Immunoglobulin Protein | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
S100A1B-9H | Native Human S100A1B | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHB6-001MCL | Recombinant Mouse EPHB6 cell lysate | +Inquiry |
SEH1L-1986HCL | Recombinant Human SEH1L 293 Cell Lysate | +Inquiry |
Heart-98M | Mouse Heart Tissue Lysate (14 Days Old) | +Inquiry |
GPR26-5789HCL | Recombinant Human GPR26 293 Cell Lysate | +Inquiry |
SYK-1320HCL | Recombinant Human SYK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket