Recombinant Full Length Staphylococcus Aureus Holin-Like Protein Cida(Cida) Protein, His-Tagged
Cat.No. : | RFL18417SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Holin-like protein CidA(cidA) Protein (Q6G6D3) (1-131aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-131) |
Form : | Lyophilized powder |
AA Sequence : | MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cidA |
Synonyms | cidA; SAS2427; Holin-like protein CidA |
UniProt ID | Q6G6D3 |
◆ Recombinant Proteins | ||
Zhx2-7107M | Recombinant Mouse Zhx2 Protein, Myc/DDK-tagged | +Inquiry |
TNFRSF10D-562H | Active Recombinant Human TNFRSF10D, Fc-tagged, Biotinylated | +Inquiry |
PRKAA2-363H | Recombinant Human PRKAA2 protein, His/MBP-tagged | +Inquiry |
S-13S | Recombinant SARS-CoV-2 S Protein, His-tagged | +Inquiry |
MSANTD1-5251H | Recombinant Human MSANTD1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1811N | Active Native Narcissus Pseudonarcissus Lectin Protein, Biotinylated | +Inquiry |
Dimer-110H | Native Human D-Dimer Protein | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB12-1951HCL | Recombinant Human ZBTB12 cell lysate | +Inquiry |
KDELC1-5003HCL | Recombinant Human KDELC1 293 Cell Lysate | +Inquiry |
SPAM1-1546HCL | Recombinant Human SPAM1 293 Cell Lysate | +Inquiry |
EPHA6-2502MCL | Recombinant Mouse EPHA6 Overexpression Lysate | +Inquiry |
COMMD5-7369HCL | Recombinant Human COMMD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cidA Products
Required fields are marked with *
My Review for All cidA Products
Required fields are marked with *
0
Inquiry Basket