Recombinant Full Length Staphylococcus Aureus Holin-Like Protein Cida(Cida) Protein, His-Tagged
Cat.No. : | RFL21184SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Holin-like protein CidA(cidA) Protein (Q5HD10) (1-131aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-131) |
Form : | Lyophilized powder |
AA Sequence : | MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cidA |
Synonyms | cidA; SACOL2554.1; Holin-like protein CidA |
UniProt ID | Q5HD10 |
◆ Native Proteins | ||
FGG -36D | Native Canine Fibrinogen | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
TnI-1050H | Native Human Cardiac Troponin I | +Inquiry |
F5-29S | Native Snake Russells Viper Venom Factor V Activator | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM168B-262HCL | Recombinant Human FAM168B lysate | +Inquiry |
MST1R-1962HCL | Recombinant Human MST1R cell lysate | +Inquiry |
FCER2-1023RCL | Recombinant Rat FCER2 cell lysate | +Inquiry |
FAM110A-6456HCL | Recombinant Human FAM110A 293 Cell Lysate | +Inquiry |
Lung-306H | Human Lung (LT Upper Lobe) Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cidA Products
Required fields are marked with *
My Review for All cidA Products
Required fields are marked with *
0
Inquiry Basket