Recombinant Full Length Staphylococcus Aureus Heme Sensor Protein Hsss(Hsss) Protein, His-Tagged
Cat.No. : | RFL14091SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Heme sensor protein hssS(hssS) Protein (A8Z553) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP THIQQYFKHLGQMNYQIMTIDQKGHKTFYGEPFREDTLSQNAINNVLNNQDYHGIKDKPF ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE LDNHQHLLFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hssS |
Synonyms | hssS; USA300HOU_2345; Heme sensor protein HssS |
UniProt ID | A8Z553 |
◆ Recombinant Proteins | ||
RFL25282AF | Recombinant Full Length Arabidopsis Thaliana Oleosin 5(At3G01570) Protein, His-Tagged | +Inquiry |
cfaB-3835E | Recombinant Escherichia coli cfaB protein, His-SUMO & Myc-tagged | +Inquiry |
BTK-1966H | Recombinant Human BTK protein, His-GST-tagged | +Inquiry |
MTERFD1-10182M | Recombinant Mouse MTERFD1 Protein | +Inquiry |
SNRPA1-4376R | Recombinant Rhesus monkey SNRPA1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
PLE-172P | Active Native Porcine Esterase | +Inquiry |
IgG-147R | Native Rabbit IgG Fab fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKP-3270HCL | Recombinant Human PFKP 293 Cell Lysate | +Inquiry |
UTP3-1561HCL | Recombinant Human UTP3 cell lysate | +Inquiry |
ZC3H10-208HCL | Recombinant Human ZC3H10 293 Cell Lysate | +Inquiry |
CDH17-1483RCL | Recombinant Rat CDH17 cell lysate | +Inquiry |
ACP5-2809HCL | Recombinant Human ACP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hssS Products
Required fields are marked with *
My Review for All hssS Products
Required fields are marked with *
0
Inquiry Basket